data_1A23 # _entry.id 1A23 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1A23 pdb_00001a23 10.2210/pdb1a23/pdb WWPDB D_1000170297 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1A24 _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A23 _pdbx_database_status.recvd_initial_deposition_date 1998-01-15 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schirra, H.J.' 1 'Renner, C.' 2 'Czisch, M.' 3 'Huber-Wunderlich, M.' 4 'Holak, T.A.' 5 'Glockshuber, R.' 6 # _citation.id primary _citation.title 'Structure of reduced DsbA from Escherichia coli in solution.' _citation.journal_abbrev Biochemistry _citation.journal_volume 37 _citation.page_first 6263 _citation.page_last 6276 _citation.year 1998 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9572841 _citation.pdbx_database_id_DOI 10.1021/bi980136y # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schirra, H.J.' 1 ? primary 'Renner, C.' 2 ? primary 'Czisch, M.' 3 ? primary 'Huber-Wunderlich, M.' 4 ? primary 'Holak, T.A.' 5 ? primary 'Glockshuber, R.' 6 ? # _cell.entry_id 1A23 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1A23 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description DSBA _entity.formula_weight 21155.025 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAM ALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQ LNPQGMDTSNMDVFVQQYADTVKYLSEKK ; _entity_poly.pdbx_seq_one_letter_code_can ;AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAM ALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQ LNPQGMDTSNMDVFVQQYADTVKYLSEKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 TYR n 1 4 GLU n 1 5 ASP n 1 6 GLY n 1 7 LYS n 1 8 GLN n 1 9 TYR n 1 10 THR n 1 11 THR n 1 12 LEU n 1 13 GLU n 1 14 LYS n 1 15 PRO n 1 16 VAL n 1 17 ALA n 1 18 GLY n 1 19 ALA n 1 20 PRO n 1 21 GLN n 1 22 VAL n 1 23 LEU n 1 24 GLU n 1 25 PHE n 1 26 PHE n 1 27 SER n 1 28 PHE n 1 29 PHE n 1 30 CYS n 1 31 PRO n 1 32 HIS n 1 33 CYS n 1 34 TYR n 1 35 GLN n 1 36 PHE n 1 37 GLU n 1 38 GLU n 1 39 VAL n 1 40 LEU n 1 41 HIS n 1 42 ILE n 1 43 SER n 1 44 ASP n 1 45 ASN n 1 46 VAL n 1 47 LYS n 1 48 LYS n 1 49 LYS n 1 50 LEU n 1 51 PRO n 1 52 GLU n 1 53 GLY n 1 54 VAL n 1 55 LYS n 1 56 MET n 1 57 THR n 1 58 LYS n 1 59 TYR n 1 60 HIS n 1 61 VAL n 1 62 ASN n 1 63 PHE n 1 64 MET n 1 65 GLY n 1 66 GLY n 1 67 ASP n 1 68 LEU n 1 69 GLY n 1 70 LYS n 1 71 ASP n 1 72 LEU n 1 73 THR n 1 74 GLN n 1 75 ALA n 1 76 TRP n 1 77 ALA n 1 78 VAL n 1 79 ALA n 1 80 MET n 1 81 ALA n 1 82 LEU n 1 83 GLY n 1 84 VAL n 1 85 GLU n 1 86 ASP n 1 87 LYS n 1 88 VAL n 1 89 THR n 1 90 VAL n 1 91 PRO n 1 92 LEU n 1 93 PHE n 1 94 GLU n 1 95 GLY n 1 96 VAL n 1 97 GLN n 1 98 LYS n 1 99 THR n 1 100 GLN n 1 101 THR n 1 102 ILE n 1 103 ARG n 1 104 SER n 1 105 ALA n 1 106 SER n 1 107 ASP n 1 108 ILE n 1 109 ARG n 1 110 ASP n 1 111 VAL n 1 112 PHE n 1 113 ILE n 1 114 ASN n 1 115 ALA n 1 116 GLY n 1 117 ILE n 1 118 LYS n 1 119 GLY n 1 120 GLU n 1 121 GLU n 1 122 TYR n 1 123 ASP n 1 124 ALA n 1 125 ALA n 1 126 TRP n 1 127 ASN n 1 128 SER n 1 129 PHE n 1 130 VAL n 1 131 VAL n 1 132 LYS n 1 133 SER n 1 134 LEU n 1 135 VAL n 1 136 ALA n 1 137 GLN n 1 138 GLN n 1 139 GLU n 1 140 LYS n 1 141 ALA n 1 142 ALA n 1 143 ALA n 1 144 ASP n 1 145 VAL n 1 146 GLN n 1 147 LEU n 1 148 ARG n 1 149 GLY n 1 150 VAL n 1 151 PRO n 1 152 ALA n 1 153 MET n 1 154 PHE n 1 155 VAL n 1 156 ASN n 1 157 GLY n 1 158 LYS n 1 159 TYR n 1 160 GLN n 1 161 LEU n 1 162 ASN n 1 163 PRO n 1 164 GLN n 1 165 GLY n 1 166 MET n 1 167 ASP n 1 168 THR n 1 169 SER n 1 170 ASN n 1 171 MET n 1 172 ASP n 1 173 VAL n 1 174 PHE n 1 175 VAL n 1 176 GLN n 1 177 GLN n 1 178 TYR n 1 179 ALA n 1 180 ASP n 1 181 THR n 1 182 VAL n 1 183 LYS n 1 184 TYR n 1 185 LEU n 1 186 SER n 1 187 GLU n 1 188 LYS n 1 189 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene DSBA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain THZ2 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location PERIPLASM _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene DSBA _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain THZ2 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location PERIPLASM _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PDSBA2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DSBA_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P24991 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKKIWLALAGLVLAFSASAAQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHV NFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKA AADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A23 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P24991 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 208 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 189 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 15N-NOESY-HSQC 1 2 1 13C-NOESY-HSQC 1 3 1 15N-HSQC 1 4 1 13C-HSQC 1 5 1 HNCA 1 6 1 HNCO 1 7 1 'CBCA(CO)NH' 1 8 1 'HN(CA)CO' 1 9 1 HNHA 1 10 1 'HBHA(CBCACO)NH' 1 11 1 NOESY 1 12 1 TOCSY 1 13 1 HCCH-TOCSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure 1013 _pdbx_nmr_exptl_sample_conditions.pH 3.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20mM _pdbx_nmr_exptl_sample_conditions.pressure_units HPA _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20 MM SODIUM PHOSPHATE IN H2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 AMX600 Bruker 600 2 DRX600 Bruker 750 3 DMX750 Bruker 750 # _pdbx_nmr_refine.entry_id 1A23 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1A23 _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED WITH TRIPLE-RESONANCE NMR SPECTROSCOPY AND MULTIDIMENSIONAL NMR EXPERIMENTS ON 13C/15N LABELED DSBA' # _pdbx_nmr_ensemble.entry_id 1A23 _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'ENERGY MINIMIZED MEAN STRUCTURE' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.851 BRUNGER 1 'structure solution' CCNMR ? ? 2 # _exptl.entry_id 1A23 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1A23 _struct.title 'SOLUTION NMR STRUCTURE OF REDUCED DSBA FROM ESCHERICHIA COLI, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A23 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'THIOL-DISULFIDE OXIDOREDUCTASE, INTRODUCTION OF DISULFIDE BONDS, PROTEIN FOLDING, REDOX-ACTIVE CENTER, OXIDOREDUCTASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 31 ? GLU A 37 ? PRO A 31 GLU A 37 1 ? 7 HELX_P HELX_P2 "1'" ILE A 42 ? LYS A 48 ? ILE A 42 LYS A 48 1 ? 7 HELX_P HELX_P3 2 LEU A 68 ? LEU A 82 ? LEU A 68 LEU A 82 1 ? 15 HELX_P HELX_P4 3 GLU A 85 ? GLN A 97 ? GLU A 85 GLN A 97 1 ? 13 HELX_P HELX_P5 4 ALA A 105 ? ALA A 115 ? ALA A 105 ALA A 115 1 ? 11 HELX_P HELX_P6 5 GLY A 119 ? ASN A 127 ? GLY A 119 ASN A 127 1 ? 9 HELX_P HELX_P7 6 VAL A 130 ? ASP A 144 ? VAL A 130 ASP A 144 1 ? 15 HELX_P HELX_P8 7 MET A 171 ? GLU A 187 ? MET A 171 GLU A 187 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 150 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 150 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 151 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 151 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.68 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 9 ? THR A 11 ? TYR A 9 THR A 11 A 2 TYR A 159 ? LEU A 161 ? TYR A 159 LEU A 161 A 3 ALA A 152 ? VAL A 155 ? ALA A 152 VAL A 155 A 4 VAL A 22 ? PHE A 25 ? VAL A 22 PHE A 25 A 5 MET A 56 ? TYR A 59 ? MET A 56 TYR A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 10 ? O THR A 10 N GLN A 160 ? N GLN A 160 A 2 3 O TYR A 159 ? O TYR A 159 N VAL A 155 ? N VAL A 155 A 3 4 O PHE A 154 ? O PHE A 154 N LEU A 23 ? N LEU A 23 A 4 5 O VAL A 22 ? O VAL A 22 N THR A 57 ? N THR A 57 # _database_PDB_matrix.entry_id 1A23 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A23 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 MET 153 153 153 MET MET A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 MET 166 166 166 MET MET A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 MET 171 171 171 MET MET A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 TYR 184 184 184 TYR TYR A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 LYS 189 189 189 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-09-16 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.851 ? 1 X-PLOR refinement 3.851 ? 2 X-PLOR phasing 3.851 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A THR 89 ? ? H A PHE 93 ? ? 1.44 2 1 H A LEU 23 ? ? O A PHE 154 ? ? 1.59 3 1 H A SER 104 ? ? OD2 A ASP 107 ? ? 1.59 4 1 H A VAL 155 ? ? O A TYR 159 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 3 ? ? 80.48 105.44 2 1 ASP A 5 ? ? 52.90 90.93 3 1 ALA A 19 ? ? -45.36 158.61 4 1 VAL A 22 ? ? -153.21 80.38 5 1 PHE A 28 ? ? -91.66 53.07 6 1 PHE A 29 ? ? -150.97 7.25 7 1 CYS A 33 ? ? -29.57 -63.62 8 1 GLU A 38 ? ? -132.58 -40.82 9 1 VAL A 39 ? ? -106.63 -70.00 10 1 HIS A 41 ? ? 59.11 18.84 11 1 PHE A 63 ? ? -140.73 57.24 12 1 MET A 64 ? ? -151.50 54.61 13 1 ASP A 67 ? ? -87.49 -80.22 14 1 LYS A 98 ? ? -152.48 47.41 15 1 THR A 99 ? ? -179.33 -48.60 16 1 ARG A 103 ? ? -141.98 25.78 17 1 GLN A 146 ? ? 86.40 -43.65 18 1 LEU A 147 ? ? 65.35 137.95 19 1 ARG A 148 ? ? -159.59 26.15 20 1 LYS A 158 ? ? -159.19 -32.69 21 1 THR A 168 ? ? -95.14 -87.54 22 1 SER A 169 ? ? -163.47 26.52 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 103 ? ? 0.300 'SIDE CHAIN' 2 1 ARG A 109 ? ? 0.137 'SIDE CHAIN' 3 1 ARG A 148 ? ? 0.321 'SIDE CHAIN' #