data_1A2J # _entry.id 1A2J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1A2J pdb_00001a2j 10.2210/pdb1a2j/pdb WWPDB D_1000170312 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A2J _pdbx_database_status.recvd_initial_deposition_date 1998-01-06 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Martin, J.L.' 1 'Guddat, L.W.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structures of reduced and oxidized DsbA: investigation of domain motion and thiolate stabilization.' Structure 6 757 767 1998 STRUE6 UK 0969-2126 2005 ? 9655827 '10.1016/S0969-2126(98)00077-X' 1 ;The Uncharged Surface Features Surrounding the Active Site of Escherichia Coli Dsba are Conserved and are Implicated in Peptide Binding ; 'Protein Sci.' 6 1148 ? 1997 PRCIEI US 0961-8368 0795 ? ? ? 2 'Structural Analysis of Three His32 Mutants of Dsba: Support for an Electrostatic Role of His32 in Dsba Stability' 'Protein Sci.' 6 1893 ? 1997 PRCIEI US 0961-8368 0795 ? ? ? 3 'Crystal Structure of the Dsba Protein Required for Disulphide Bond Formation in Vivo' Nature 365 464 ? 1993 NATUAS UK 0028-0836 0006 ? ? ? 4 'Crystallization of Dsba, an Escherichia Coli Protein Required for Disulphide Bond Formation in Vivo' J.Mol.Biol. 230 1097 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guddat, L.W.' 1 ? primary 'Bardwell, J.C.' 2 ? primary 'Martin, J.L.' 3 ? 1 'Guddat, L.W.' 4 ? 1 'Bardwell, J.C.' 5 ? 1 'Zander, T.' 6 ? 1 'Martin, J.L.' 7 ? 2 'Guddat, L.W.' 8 ? 2 'Bardwell, J.C.' 9 ? 2 'Glockshuber, R.' 10 ? 2 'Huber-Wunderlich, M.' 11 ? 2 'Zander, T.' 12 ? 2 'Martin, J.L.' 13 ? 3 'Martin, J.L.' 14 ? 3 'Bardwell, J.C.' 15 ? 3 'Kuriyan, J.' 16 ? 4 'Martin, J.L.' 17 ? 4 'Waksman, G.' 18 ? 4 'Bardwell, J.C.' 19 ? 4 'Beckwith, J.' 20 ? 4 'Kuriyan, J.' 21 ? # _cell.entry_id 1A2J _cell.length_a 38.520 _cell.length_b 51.380 _cell.length_c 42.500 _cell.angle_alpha 90.00 _cell.angle_beta 103.08 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1A2J _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'DISULFIDE BOND FORMATION PROTEIN' 21155.025 1 ? ? ? ? 2 water nat water 18.015 90 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name DSBA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAM ALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQ LNPQGMDTSNMDVFVQQYADTVKYLSEKK ; _entity_poly.pdbx_seq_one_letter_code_can ;AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAM ALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQ LNPQGMDTSNMDVFVQQYADTVKYLSEKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 TYR n 1 4 GLU n 1 5 ASP n 1 6 GLY n 1 7 LYS n 1 8 GLN n 1 9 TYR n 1 10 THR n 1 11 THR n 1 12 LEU n 1 13 GLU n 1 14 LYS n 1 15 PRO n 1 16 VAL n 1 17 ALA n 1 18 GLY n 1 19 ALA n 1 20 PRO n 1 21 GLN n 1 22 VAL n 1 23 LEU n 1 24 GLU n 1 25 PHE n 1 26 PHE n 1 27 SER n 1 28 PHE n 1 29 PHE n 1 30 CYS n 1 31 PRO n 1 32 HIS n 1 33 CYS n 1 34 TYR n 1 35 GLN n 1 36 PHE n 1 37 GLU n 1 38 GLU n 1 39 VAL n 1 40 LEU n 1 41 HIS n 1 42 ILE n 1 43 SER n 1 44 ASP n 1 45 ASN n 1 46 VAL n 1 47 LYS n 1 48 LYS n 1 49 LYS n 1 50 LEU n 1 51 PRO n 1 52 GLU n 1 53 GLY n 1 54 VAL n 1 55 LYS n 1 56 MET n 1 57 THR n 1 58 LYS n 1 59 TYR n 1 60 HIS n 1 61 VAL n 1 62 ASN n 1 63 PHE n 1 64 MET n 1 65 GLY n 1 66 GLY n 1 67 ASP n 1 68 LEU n 1 69 GLY n 1 70 LYS n 1 71 ASP n 1 72 LEU n 1 73 THR n 1 74 GLN n 1 75 ALA n 1 76 TRP n 1 77 ALA n 1 78 VAL n 1 79 ALA n 1 80 MET n 1 81 ALA n 1 82 LEU n 1 83 GLY n 1 84 VAL n 1 85 GLU n 1 86 ASP n 1 87 LYS n 1 88 VAL n 1 89 THR n 1 90 VAL n 1 91 PRO n 1 92 LEU n 1 93 PHE n 1 94 GLU n 1 95 GLY n 1 96 VAL n 1 97 GLN n 1 98 LYS n 1 99 THR n 1 100 GLN n 1 101 THR n 1 102 ILE n 1 103 ARG n 1 104 SER n 1 105 ALA n 1 106 SER n 1 107 ASP n 1 108 ILE n 1 109 ARG n 1 110 ASP n 1 111 VAL n 1 112 PHE n 1 113 ILE n 1 114 ASN n 1 115 ALA n 1 116 GLY n 1 117 ILE n 1 118 LYS n 1 119 GLY n 1 120 GLU n 1 121 GLU n 1 122 TYR n 1 123 ASP n 1 124 ALA n 1 125 ALA n 1 126 TRP n 1 127 ASN n 1 128 SER n 1 129 PHE n 1 130 VAL n 1 131 VAL n 1 132 LYS n 1 133 SER n 1 134 LEU n 1 135 VAL n 1 136 ALA n 1 137 GLN n 1 138 GLN n 1 139 GLU n 1 140 LYS n 1 141 ALA n 1 142 ALA n 1 143 ALA n 1 144 ASP n 1 145 VAL n 1 146 GLN n 1 147 LEU n 1 148 ARG n 1 149 GLY n 1 150 VAL n 1 151 PRO n 1 152 ALA n 1 153 MET n 1 154 PHE n 1 155 VAL n 1 156 ASN n 1 157 GLY n 1 158 LYS n 1 159 TYR n 1 160 GLN n 1 161 LEU n 1 162 ASN n 1 163 PRO n 1 164 GLN n 1 165 GLY n 1 166 MET n 1 167 ASP n 1 168 THR n 1 169 SER n 1 170 ASN n 1 171 MET n 1 172 ASP n 1 173 VAL n 1 174 PHE n 1 175 VAL n 1 176 GLN n 1 177 GLN n 1 178 TYR n 1 179 ALA n 1 180 ASP n 1 181 THR n 1 182 VAL n 1 183 LYS n 1 184 TYR n 1 185 LEU n 1 186 SER n 1 187 GLU n 1 188 LYS n 1 189 LYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Escherichia coli' _entity_src_nat.pdbx_ncbi_taxonomy_id 562 _entity_src_nat.genus Escherichia _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location PERIPLASM _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DSBA_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P24991 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKKIWLALAGLVLAFSASAAQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHV NFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKA AADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A2J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P24991 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 208 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 189 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1A2J _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.94 _exptl_crystal.density_percent_sol 37. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '27% PEG 4K IN 0.1M ACETATE BUFFER PH 5.0' # _diffrn.id 1 _diffrn.ambient_temp 289 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type RIGAKU _diffrn_detector.pdbx_collection_date 1995-10-10 _diffrn_detector.details 'YALE MIRRORS' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1A2J _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.0 _reflns.number_obs 38303 _reflns.number_all ? _reflns.percent_possible_obs 94.2 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_Rsym_value 0.046 _reflns.pdbx_netI_over_sigmaI 16.0 _reflns.B_iso_Wilson_estimate 18.8 _reflns.pdbx_redundancy 3.8 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 81.60 _reflns_shell.Rmerge_I_obs 0.153 _reflns_shell.pdbx_Rsym_value 0.153 _reflns_shell.meanI_over_sigI_obs 7.4 _reflns_shell.pdbx_redundancy 3.4 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1A2J _refine.ls_number_reflns_obs 10332 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.0 _refine.pdbx_data_cutoff_high_absF 10000000. _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.0 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs 93.3 _refine.ls_R_factor_obs 0.182 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.182 _refine.ls_R_factor_R_free 0.227 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free 1069 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 23.6 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ;EIGHT RESIDUES GLU 4, GLU 13, LYS 48, LYS 98, GLU 120, LYS 132, GLN 146, AND LYS 183 WERE MODELLED AS ALANINE BECAUSE OF POORLY DEFINED SIDE CHAIN DENSITY. RESIDUES GLU 85, SER 106, SER 133, AND SER 186 WERE MODELLED WITH TWO ALTERNATE CONFORMATIONS, EACH OF HALF OCCUPANCY. THE SIDE CHAINS OF GLU 13, GLU 85, SER 106, SER 133, AND SER 186 WERE MODELLED WITH TWO ALTERNATE CONFORMATIONS, EACH OF HALF OCCUPANCY. ; _refine.pdbx_starting_model 'PDB ENTRY 1FVK' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1A2J _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs 50.0 _refine_analyze.Luzzati_coordinate_error_free 0.30 _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1446 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 90 _refine_hist.number_atoms_total 1536 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 50.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.005 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.00 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 22.4 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 0.96 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.0 _refine_ls_shell.d_res_low 2.09 _refine_ls_shell.number_reflns_R_work 963 _refine_ls_shell.R_factor_R_work 0.249 _refine_ls_shell.percent_reflns_obs 79.0 _refine_ls_shell.R_factor_R_free 0.247 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 9.16 _refine_ls_shell.number_reflns_R_free 126 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 1A2J _struct.title 'OXIDIZED DSBA CRYSTAL FORM II' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A2J _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'OXIDOREDUCTASE, PROTEIN DISULFIDE ISOMERASE, PROTEIN FOLDING, REDOX PROTEIN, REDOX-ACTIVE CENTER' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 PRO A 31 ? GLU A 38 ? PRO A 31 GLU A 38 1 ? 8 HELX_P HELX_P2 H2 ILE A 42 ? LYS A 49 ? ILE A 42 LYS A 49 1 ? 8 HELX_P HELX_P3 H3 GLY A 66 ? LEU A 82 ? GLY A 66 LEU A 82 1 ? 17 HELX_P HELX_P4 H4 GLU A 85 ? GLN A 97 ? GLU A 85 GLN A 97 1 ? 13 HELX_P HELX_P5 H5 ALA A 105 ? ASN A 114 ? ALA A 105 ASN A 114 1 ? 10 HELX_P HELX_P6 H6 GLY A 119 ? ASN A 127 ? GLY A 119 ASN A 127 1 ? 9 HELX_P HELX_P7 H7 PHE A 129 ? ASP A 144 ? PHE A 129 ASP A 144 1 ? 16 HELX_P HELX_P8 H8 PRO A 163 ? GLY A 165 ? PRO A 163 GLY A 165 1 ? 3 HELX_P HELX_P9 H9 MET A 171 ? SER A 186 ? MET A 171 SER A 186 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 30 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 33 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 30 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 33 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.029 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 150 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 150 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 151 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 151 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.19 # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 1 _struct_sheet.details ? # _struct_sheet_range.sheet_id S1 _struct_sheet_range.id 1 _struct_sheet_range.beg_label_comp_id TYR _struct_sheet_range.beg_label_asym_id A _struct_sheet_range.beg_label_seq_id 9 _struct_sheet_range.pdbx_beg_PDB_ins_code ? _struct_sheet_range.end_label_comp_id THR _struct_sheet_range.end_label_asym_id A _struct_sheet_range.end_label_seq_id 11 _struct_sheet_range.pdbx_end_PDB_ins_code ? _struct_sheet_range.beg_auth_comp_id TYR _struct_sheet_range.beg_auth_asym_id A _struct_sheet_range.beg_auth_seq_id 9 _struct_sheet_range.end_auth_comp_id THR _struct_sheet_range.end_auth_asym_id A _struct_sheet_range.end_auth_seq_id 11 # _struct_site.id CAA _struct_site.pdbx_evidence_code Unknown _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'THE ACTIVE SITE.' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAA 4 CYS A 30 ? CYS A 30 . ? 1_555 ? 2 CAA 4 PRO A 31 ? PRO A 31 . ? 1_555 ? 3 CAA 4 HIS A 32 ? HIS A 32 . ? 1_555 ? 4 CAA 4 CYS A 33 ? CYS A 33 . ? 1_555 ? # _database_PDB_matrix.entry_id 1A2J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A2J _atom_sites.fract_transf_matrix[1][1] 0.025961 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006032 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019463 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024156 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 MET 153 153 153 MET MET A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 MET 166 166 166 MET MET A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 MET 171 171 171 MET MET A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 TYR 184 184 184 TYR TYR A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 LYS 189 189 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 301 HOH HOH A . B 2 HOH 2 302 302 HOH HOH A . B 2 HOH 3 303 303 HOH HOH A . B 2 HOH 4 304 304 HOH HOH A . B 2 HOH 5 305 305 HOH HOH A . B 2 HOH 6 306 306 HOH HOH A . B 2 HOH 7 307 307 HOH HOH A . B 2 HOH 8 308 308 HOH HOH A . B 2 HOH 9 309 309 HOH HOH A . B 2 HOH 10 310 310 HOH HOH A . B 2 HOH 11 311 311 HOH HOH A . B 2 HOH 12 312 312 HOH HOH A . B 2 HOH 13 313 313 HOH HOH A . B 2 HOH 14 314 314 HOH HOH A . B 2 HOH 15 315 315 HOH HOH A . B 2 HOH 16 316 316 HOH HOH A . B 2 HOH 17 317 317 HOH HOH A . B 2 HOH 18 318 318 HOH HOH A . B 2 HOH 19 319 319 HOH HOH A . B 2 HOH 20 320 320 HOH HOH A . B 2 HOH 21 321 321 HOH HOH A . B 2 HOH 22 322 322 HOH HOH A . B 2 HOH 23 323 323 HOH HOH A . B 2 HOH 24 324 324 HOH HOH A . B 2 HOH 25 325 325 HOH HOH A . B 2 HOH 26 326 326 HOH HOH A . B 2 HOH 27 327 327 HOH HOH A . B 2 HOH 28 328 328 HOH HOH A . B 2 HOH 29 329 329 HOH HOH A . B 2 HOH 30 330 330 HOH HOH A . B 2 HOH 31 331 331 HOH HOH A . B 2 HOH 32 332 332 HOH HOH A . B 2 HOH 33 333 333 HOH HOH A . B 2 HOH 34 334 334 HOH HOH A . B 2 HOH 35 335 335 HOH HOH A . B 2 HOH 36 336 336 HOH HOH A . B 2 HOH 37 337 337 HOH HOH A . B 2 HOH 38 338 338 HOH HOH A . B 2 HOH 39 339 339 HOH HOH A . B 2 HOH 40 340 340 HOH HOH A . B 2 HOH 41 341 341 HOH HOH A . B 2 HOH 42 342 342 HOH HOH A . B 2 HOH 43 343 343 HOH HOH A . B 2 HOH 44 344 344 HOH HOH A . B 2 HOH 45 345 345 HOH HOH A . B 2 HOH 46 346 346 HOH HOH A . B 2 HOH 47 347 347 HOH HOH A . B 2 HOH 48 348 348 HOH HOH A . B 2 HOH 49 349 349 HOH HOH A . B 2 HOH 50 350 350 HOH HOH A . B 2 HOH 51 351 351 HOH HOH A . B 2 HOH 52 352 352 HOH HOH A . B 2 HOH 53 353 353 HOH HOH A . B 2 HOH 54 354 354 HOH HOH A . B 2 HOH 55 355 355 HOH HOH A . B 2 HOH 56 356 356 HOH HOH A . B 2 HOH 57 357 357 HOH HOH A . B 2 HOH 58 358 358 HOH HOH A . B 2 HOH 59 359 359 HOH HOH A . B 2 HOH 60 360 360 HOH HOH A . B 2 HOH 61 361 361 HOH HOH A . B 2 HOH 62 362 362 HOH HOH A . B 2 HOH 63 363 363 HOH HOH A . B 2 HOH 64 364 364 HOH HOH A . B 2 HOH 65 365 365 HOH HOH A . B 2 HOH 66 366 366 HOH HOH A . B 2 HOH 67 367 367 HOH HOH A . B 2 HOH 68 368 368 HOH HOH A . B 2 HOH 69 369 369 HOH HOH A . B 2 HOH 70 370 370 HOH HOH A . B 2 HOH 71 371 371 HOH HOH A . B 2 HOH 72 372 372 HOH HOH A . B 2 HOH 73 373 373 HOH HOH A . B 2 HOH 74 374 374 HOH HOH A . B 2 HOH 75 375 375 HOH HOH A . B 2 HOH 76 376 376 HOH HOH A . B 2 HOH 77 377 377 HOH HOH A . B 2 HOH 78 378 378 HOH HOH A . B 2 HOH 79 379 379 HOH HOH A . B 2 HOH 80 380 380 HOH HOH A . B 2 HOH 81 381 381 HOH HOH A . B 2 HOH 82 382 382 HOH HOH A . B 2 HOH 83 383 383 HOH HOH A . B 2 HOH 84 384 384 HOH HOH A . B 2 HOH 85 385 385 HOH HOH A . B 2 HOH 86 386 386 HOH HOH A . B 2 HOH 87 387 387 HOH HOH A . B 2 HOH 88 388 388 HOH HOH A . B 2 HOH 89 389 389 HOH HOH A . B 2 HOH 90 390 390 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-09-16 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 X-PLOR 'model building' 3.1 ? 3 X-PLOR refinement 3.1 ? 4 X-PLOR phasing 3.1 ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 7 ? ? -87.98 -87.20 2 1 PHE A 29 ? ? -100.96 41.63 3 1 VAL A 39 ? ? -91.01 -69.89 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 4 ? CG ? A GLU 4 CG 2 1 Y 1 A GLU 4 ? CD ? A GLU 4 CD 3 1 Y 1 A GLU 4 ? OE1 ? A GLU 4 OE1 4 1 Y 1 A GLU 4 ? OE2 ? A GLU 4 OE2 5 1 Y 1 A GLU 13 ? CG ? A GLU 13 CG 6 1 Y 1 A GLU 13 ? CD ? A GLU 13 CD 7 1 Y 1 A GLU 13 ? OE1 ? A GLU 13 OE1 8 1 Y 1 A GLU 13 ? OE2 ? A GLU 13 OE2 9 1 Y 1 A LYS 48 ? CG ? A LYS 48 CG 10 1 Y 1 A LYS 48 ? CD ? A LYS 48 CD 11 1 Y 1 A LYS 48 ? CE ? A LYS 48 CE 12 1 Y 1 A LYS 48 ? NZ ? A LYS 48 NZ 13 1 Y 1 A LYS 98 ? CG ? A LYS 98 CG 14 1 Y 1 A LYS 98 ? CD ? A LYS 98 CD 15 1 Y 1 A LYS 98 ? CE ? A LYS 98 CE 16 1 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 17 1 Y 1 A LYS 118 ? CG ? A LYS 118 CG 18 1 Y 1 A LYS 118 ? CD ? A LYS 118 CD 19 1 Y 1 A LYS 118 ? CE ? A LYS 118 CE 20 1 Y 1 A LYS 118 ? NZ ? A LYS 118 NZ 21 1 Y 1 A GLU 120 ? CG ? A GLU 120 CG 22 1 Y 1 A GLU 120 ? CD ? A GLU 120 CD 23 1 Y 1 A GLU 120 ? OE1 ? A GLU 120 OE1 24 1 Y 1 A GLU 120 ? OE2 ? A GLU 120 OE2 25 1 Y 1 A LYS 132 ? CG ? A LYS 132 CG 26 1 Y 1 A LYS 132 ? CD ? A LYS 132 CD 27 1 Y 1 A LYS 132 ? CE ? A LYS 132 CE 28 1 Y 1 A LYS 132 ? NZ ? A LYS 132 NZ 29 1 Y 1 A GLN 146 ? CG ? A GLN 146 CG 30 1 Y 1 A GLN 146 ? CD ? A GLN 146 CD 31 1 Y 1 A GLN 146 ? OE1 ? A GLN 146 OE1 32 1 Y 1 A GLN 146 ? NE2 ? A GLN 146 NE2 33 1 Y 1 A LYS 183 ? CG ? A LYS 183 CG 34 1 Y 1 A LYS 183 ? CD ? A LYS 183 CD 35 1 Y 1 A LYS 183 ? CE ? A LYS 183 CE 36 1 Y 1 A LYS 183 ? NZ ? A LYS 183 NZ # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id LYS _pdbx_unobs_or_zero_occ_residues.auth_seq_id 189 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id LYS _pdbx_unobs_or_zero_occ_residues.label_seq_id 189 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1FVK _pdbx_initial_refinement_model.details 'PDB ENTRY 1FVK' #