data_1A8L # _entry.id 1A8L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1A8L WWPDB D_1000170528 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A8L _pdbx_database_status.recvd_initial_deposition_date 1998-03-26 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ren, B.' 1 'Tibbelin, G.' 2 'Pascale, D.' 3 'Rossi, M.' 4 'Bartolucci, S.' 5 'Ladenstein, R.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'A protein disulfide oxidoreductase from the archaeon Pyrococcus furiosus contains two thioredoxin fold units.' Nat.Struct.Biol. 5 602 611 1998 NSBIEW US 1072-8368 2024 ? 9665175 10.1038/862 1 'Erratum. A Protein Disulfide Oxidoreductase from the Archaeon Pyrococcus Furiosus Contains Two Thioredoxin Fold Units' Nat.Struct.Biol. 5 924 ? 1998 NSBIEW US 1072-8368 2024 ? ? ? 2 ;Crystallization and Preliminary X-Ray Structure Analysis of a Hyperthermostable Thioltransferase from the Archaeon Pyrococcus Furiosus ; J.Struct.Biol. 119 1 ? 1997 JSBIEM US 1047-8477 0803 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ren, B.' 1 primary 'Tibbelin, G.' 2 primary 'de Pascale, D.' 3 primary 'Rossi, M.' 4 primary 'Bartolucci, S.' 5 primary 'Ladenstein, R.' 6 1 'Ren, B.' 7 1 'Tibbelin, G.' 8 1 'De Pascale, D.' 9 1 'Rossi, M.' 10 1 'Bartolucci, S.' 11 1 'Ladenstein, R.' 12 2 'Ren, B.' 13 2 'Tibbelin, G.' 14 2 'Pascale, D.' 15 2 'Rossi, M.' 16 2 'Bartolucci, S.' 17 2 'Ladenstein, R.' 18 # _cell.entry_id 1A8L _cell.length_a 110.291 _cell.length_b 110.291 _cell.length_c 68.514 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1A8L _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN DISULFIDE OXIDOREDUCTASE' 25812.666 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 139 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGLISDADKKVIKEEFFSKMVNPVKLIVFVRKDHCQYCDQLKQLVQELSELTDKLSYEIVDFDTPEGKELAKRYRIDRAP ATTITQDGKDFGVRYFGLPAGHEFAAFLEDIVDVSREETNLMDETKQAIRNIDQDVRILVFVTPTCPYCPLAVRMAHKFA IENTKAGKGKILGDMVEAIEYPEWADQYNVMAVPKIVIQVNGEDRVEFEGAYPEKMFLEKLLSALS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGLISDADKKVIKEEFFSKMVNPVKLIVFVRKDHCQYCDQLKQLVQELSELTDKLSYEIVDFDTPEGKELAKRYRIDRAP ATTITQDGKDFGVRYFGLPAGHEFAAFLEDIVDVSREETNLMDETKQAIRNIDQDVRILVFVTPTCPYCPLAVRMAHKFA IENTKAGKGKILGDMVEAIEYPEWADQYNVMAVPKIVIQVNGEDRVEFEGAYPEKMFLEKLLSALS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LEU n 1 4 ILE n 1 5 SER n 1 6 ASP n 1 7 ALA n 1 8 ASP n 1 9 LYS n 1 10 LYS n 1 11 VAL n 1 12 ILE n 1 13 LYS n 1 14 GLU n 1 15 GLU n 1 16 PHE n 1 17 PHE n 1 18 SER n 1 19 LYS n 1 20 MET n 1 21 VAL n 1 22 ASN n 1 23 PRO n 1 24 VAL n 1 25 LYS n 1 26 LEU n 1 27 ILE n 1 28 VAL n 1 29 PHE n 1 30 VAL n 1 31 ARG n 1 32 LYS n 1 33 ASP n 1 34 HIS n 1 35 CYS n 1 36 GLN n 1 37 TYR n 1 38 CYS n 1 39 ASP n 1 40 GLN n 1 41 LEU n 1 42 LYS n 1 43 GLN n 1 44 LEU n 1 45 VAL n 1 46 GLN n 1 47 GLU n 1 48 LEU n 1 49 SER n 1 50 GLU n 1 51 LEU n 1 52 THR n 1 53 ASP n 1 54 LYS n 1 55 LEU n 1 56 SER n 1 57 TYR n 1 58 GLU n 1 59 ILE n 1 60 VAL n 1 61 ASP n 1 62 PHE n 1 63 ASP n 1 64 THR n 1 65 PRO n 1 66 GLU n 1 67 GLY n 1 68 LYS n 1 69 GLU n 1 70 LEU n 1 71 ALA n 1 72 LYS n 1 73 ARG n 1 74 TYR n 1 75 ARG n 1 76 ILE n 1 77 ASP n 1 78 ARG n 1 79 ALA n 1 80 PRO n 1 81 ALA n 1 82 THR n 1 83 THR n 1 84 ILE n 1 85 THR n 1 86 GLN n 1 87 ASP n 1 88 GLY n 1 89 LYS n 1 90 ASP n 1 91 PHE n 1 92 GLY n 1 93 VAL n 1 94 ARG n 1 95 TYR n 1 96 PHE n 1 97 GLY n 1 98 LEU n 1 99 PRO n 1 100 ALA n 1 101 GLY n 1 102 HIS n 1 103 GLU n 1 104 PHE n 1 105 ALA n 1 106 ALA n 1 107 PHE n 1 108 LEU n 1 109 GLU n 1 110 ASP n 1 111 ILE n 1 112 VAL n 1 113 ASP n 1 114 VAL n 1 115 SER n 1 116 ARG n 1 117 GLU n 1 118 GLU n 1 119 THR n 1 120 ASN n 1 121 LEU n 1 122 MET n 1 123 ASP n 1 124 GLU n 1 125 THR n 1 126 LYS n 1 127 GLN n 1 128 ALA n 1 129 ILE n 1 130 ARG n 1 131 ASN n 1 132 ILE n 1 133 ASP n 1 134 GLN n 1 135 ASP n 1 136 VAL n 1 137 ARG n 1 138 ILE n 1 139 LEU n 1 140 VAL n 1 141 PHE n 1 142 VAL n 1 143 THR n 1 144 PRO n 1 145 THR n 1 146 CYS n 1 147 PRO n 1 148 TYR n 1 149 CYS n 1 150 PRO n 1 151 LEU n 1 152 ALA n 1 153 VAL n 1 154 ARG n 1 155 MET n 1 156 ALA n 1 157 HIS n 1 158 LYS n 1 159 PHE n 1 160 ALA n 1 161 ILE n 1 162 GLU n 1 163 ASN n 1 164 THR n 1 165 LYS n 1 166 ALA n 1 167 GLY n 1 168 LYS n 1 169 GLY n 1 170 LYS n 1 171 ILE n 1 172 LEU n 1 173 GLY n 1 174 ASP n 1 175 MET n 1 176 VAL n 1 177 GLU n 1 178 ALA n 1 179 ILE n 1 180 GLU n 1 181 TYR n 1 182 PRO n 1 183 GLU n 1 184 TRP n 1 185 ALA n 1 186 ASP n 1 187 GLN n 1 188 TYR n 1 189 ASN n 1 190 VAL n 1 191 MET n 1 192 ALA n 1 193 VAL n 1 194 PRO n 1 195 LYS n 1 196 ILE n 1 197 VAL n 1 198 ILE n 1 199 GLN n 1 200 VAL n 1 201 ASN n 1 202 GLY n 1 203 GLU n 1 204 ASP n 1 205 ARG n 1 206 VAL n 1 207 GLU n 1 208 PHE n 1 209 GLU n 1 210 GLY n 1 211 ALA n 1 212 TYR n 1 213 PRO n 1 214 GLU n 1 215 LYS n 1 216 MET n 1 217 PHE n 1 218 LEU n 1 219 GLU n 1 220 LYS n 1 221 LEU n 1 222 LEU n 1 223 SER n 1 224 ALA n 1 225 LEU n 1 226 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q51760_PYRFU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q51760 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MGLISDADKKVIKEEFFSKMVNPVKLIVFVRKDHCQYCDQLKQLVQELSELTDKLSYEIVDFDTPEGKELAKRYRIDRAP ATTITQDGKDFGVRYFGLPAGHEFAAFLEDIVDVSREETNLMDETKQAIRNIDQDVRILVFVTPTCPYCPLAVRMAHKFA IENTKAGKGKILGDMVEAIEYPEWADQYNVMAVPKIVIQVNGEDRVEFEGAYPEKMFLEKLLSALS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A8L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 226 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q51760 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 226 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 226 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1A8L _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.4 _exptl_crystal.density_percent_sol 49.0 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 6.0' # _diffrn.id 1 _diffrn.ambient_temp 288 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1997-05 _diffrn_detector.details COLLIMATOR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type MACSCIENCE _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1A8L _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high 1.90 _reflns.number_obs 20703 _reflns.number_all ? _reflns.percent_possible_obs 99 _reflns.pdbx_Rmerge_I_obs 0.069 _reflns.pdbx_Rsym_value 0.12 _reflns.pdbx_netI_over_sigmaI 27 _reflns.B_iso_Wilson_estimate 30.0 _reflns.pdbx_redundancy 16.0 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.9 _reflns_shell.d_res_low 2.0 _reflns_shell.percent_possible_all 96 _reflns_shell.Rmerge_I_obs 0.05 _reflns_shell.pdbx_Rsym_value 0.3 _reflns_shell.meanI_over_sigI_obs 7 _reflns_shell.pdbx_redundancy 7 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1A8L _refine.ls_number_reflns_obs 19064 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 10000000.00 _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.00 _refine.ls_d_res_high 1.90 _refine.ls_percent_reflns_obs 97.5 _refine.ls_R_factor_obs 0.192 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.192 _refine.ls_R_factor_R_free 0.217 _refine.ls_R_factor_R_free_error 0.0049 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free 1906 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 28.6 _refine.aniso_B[1][1] 0.731 _refine.aniso_B[2][2] 0.731 _refine.aniso_B[3][3] 1.736 _refine.aniso_B[1][2] 0.35 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIRAS _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1A8L _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.27 _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1811 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 139 _refine_hist.number_atoms_total 1951 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 8.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 25.8 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 0.6 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 1.90 _refine_ls_shell.d_res_low 1.99 _refine_ls_shell.number_reflns_R_work 2061 _refine_ls_shell.R_factor_R_work 0.1984 _refine_ls_shell.percent_reflns_obs 96.0 _refine_ls_shell.R_factor_R_free 0.2354 _refine_ls_shell.R_factor_R_free_error 0.015 _refine_ls_shell.percent_reflns_R_free 10.1 _refine_ls_shell.number_reflns_R_free 233 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 2 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' # _struct.entry_id 1A8L _struct.title 'PROTEIN DISULFIDE OXIDOREDUCTASE FROM ARCHAEON PYROCOCCUS FURIOSUS' _struct.pdbx_descriptor 'PROTEIN DISULFIDE OXIDOREDUCTASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A8L _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'OXIDOREDUCTASE, PDI, THIOREDOXIN FOLD' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 6 ? GLU A 15 ? ASP A 6 GLU A 15 1 ? 10 HELX_P HELX_P2 2 PHE A 17 ? LYS A 19 ? PHE A 17 LYS A 19 5 ? 3 HELX_P HELX_P3 3 CYS A 38 ? LEU A 51 ? CYS A 38 LEU A 51 1 ? 14 HELX_P HELX_P4 4 PRO A 65 ? ARG A 73 ? PRO A 65 ARG A 73 1 ? 9 HELX_P HELX_P5 5 GLY A 101 ? ARG A 116 ? GLY A 101 ARG A 116 5 ? 16 HELX_P HELX_P6 6 ASP A 123 ? ASN A 131 ? ASP A 123 ASN A 131 1 ? 9 HELX_P HELX_P7 7 CYS A 149 ? LYS A 165 ? CYS A 149 LYS A 165 1 ? 17 HELX_P HELX_P8 8 PRO A 182 ? TYR A 188 ? PRO A 182 TYR A 188 1 ? 7 HELX_P HELX_P9 9 GLU A 214 ? ALA A 224 ? GLU A 214 ALA A 224 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 35 A CYS 38 1_555 ? ? ? ? ? ? ? 2.020 ? disulf2 disulf ? ? A CYS 146 SG ? ? ? 1_555 A CYS 149 SG ? ? A CYS 146 A CYS 149 1_555 ? ? ? ? ? ? ? 2.026 ? metalc1 metalc ? ? C HOH . O ? ? ? 1_555 B ZN . ZN ? ? A HOH 354 A ZN 440 1_555 ? ? ? ? ? ? ? 2.341 ? metalc2 metalc ? ? C HOH . O ? ? ? 1_555 B ZN . ZN ? ? A HOH 355 A ZN 440 1_555 ? ? ? ? ? ? ? 2.313 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 15 OE2 ? ? A ZN 440 A GLU 15 1_555 ? ? ? ? ? ? ? 1.946 ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 102 ND1 ? ? A ZN 440 A HIS 102 10_666 ? ? ? ? ? ? ? 2.091 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 79 A . ? ALA 79 A PRO 80 A ? PRO 80 A 1 0.51 2 VAL 193 A . ? VAL 193 A PRO 194 A ? PRO 194 A 1 0.13 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 55 ? ASP A 61 ? LEU A 55 ASP A 61 A 2 VAL A 24 ? VAL A 30 ? VAL A 24 VAL A 30 A 3 ALA A 81 ? GLN A 86 ? ALA A 81 GLN A 86 B 1 VAL A 93 ? PHE A 96 ? VAL A 93 PHE A 96 B 2 ILE A 171 ? GLU A 177 ? ILE A 171 GLU A 177 B 3 VAL A 136 ? VAL A 142 ? VAL A 136 VAL A 142 B 4 LYS A 195 ? VAL A 200 ? LYS A 195 VAL A 200 B 5 GLU A 203 ? GLU A 209 ? GLU A 203 GLU A 209 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 56 ? O SER A 56 N VAL A 24 ? N VAL A 24 A 2 3 O LYS A 25 ? O LYS A 25 N THR A 85 ? N THR A 85 B 1 2 O ARG A 94 ? O ARG A 94 N GLY A 173 ? N GLY A 173 B 2 3 O LEU A 172 ? O LEU A 172 N VAL A 136 ? N VAL A 136 B 3 4 O ARG A 137 ? O ARG A 137 N GLN A 199 ? N GLN A 199 B 4 5 O ILE A 196 ? O ILE A 196 N PHE A 208 ? N PHE A 208 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 440' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 15 ? GLU A 15 . ? 1_555 ? 2 AC1 4 HIS A 102 ? HIS A 102 . ? 10_666 ? 3 AC1 4 HOH C . ? HOH A 354 . ? 1_555 ? 4 AC1 4 HOH C . ? HOH A 355 . ? 1_555 ? # _database_PDB_matrix.entry_id 1A8L _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A8L _atom_sites.fract_transf_matrix[1][1] 0.009067 _atom_sites.fract_transf_matrix[1][2] 0.005235 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010470 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014596 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 CYS 146 146 146 CYS CYS A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 CYS 149 149 149 CYS CYS A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 MET 155 155 155 MET MET A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 ASN 163 163 163 ASN ASN A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 MET 175 175 175 MET MET A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 TRP 184 184 184 TRP TRP A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 TYR 188 188 188 TYR TYR A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 MET 191 191 191 MET MET A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 GLN 199 199 199 GLN GLN A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 ARG 205 205 205 ARG ARG A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 GLU 209 209 209 GLU GLU A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 PRO 213 213 213 PRO PRO A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 MET 216 216 216 MET MET A . n A 1 217 PHE 217 217 217 PHE PHE A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 SER 226 226 226 SER SER A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA,PQS dimeric 2 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C 2 1,3 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1810 ? 1 MORE -59 ? 1 'SSA (A^2)' 19560 ? 2 'ABSA (A^2)' 2140 ? 2 MORE -73 ? 2 'SSA (A^2)' 19230 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z+2/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 45.6760000000 3 'crystal symmetry operation' 10_666 -y+1,-x+1,-z+7/6 0.5000000000 -0.8660254038 0.0000000000 55.1455000000 -0.8660254038 -0.5000000000 0.0000000000 95.5148078088 0.0000000000 0.0000000000 -1.0000000000 79.9330000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 347 ? C HOH . 2 1 A HOH 424 ? C HOH . 3 1 A HOH 425 ? C HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? C HOH . ? A HOH 354 ? 1_555 ZN ? B ZN . ? A ZN 440 ? 1_555 O ? C HOH . ? A HOH 355 ? 1_555 108.3 ? 2 O ? C HOH . ? A HOH 354 ? 1_555 ZN ? B ZN . ? A ZN 440 ? 1_555 OE2 ? A GLU 15 ? A GLU 15 ? 1_555 116.9 ? 3 O ? C HOH . ? A HOH 355 ? 1_555 ZN ? B ZN . ? A ZN 440 ? 1_555 OE2 ? A GLU 15 ? A GLU 15 ? 1_555 106.9 ? 4 O ? C HOH . ? A HOH 354 ? 1_555 ZN ? B ZN . ? A ZN 440 ? 1_555 ND1 ? A HIS 102 ? A HIS 102 ? 10_666 110.0 ? 5 O ? C HOH . ? A HOH 355 ? 1_555 ZN ? B ZN . ? A ZN 440 ? 1_555 ND1 ? A HIS 102 ? A HIS 102 ? 10_666 116.2 ? 6 OE2 ? A GLU 15 ? A GLU 15 ? 1_555 ZN ? B ZN . ? A ZN 440 ? 1_555 ND1 ? A HIS 102 ? A HIS 102 ? 10_666 98.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-03-30 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2011-11-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Atomic model' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 X-PLOR 'model building' 3.851 ? 3 X-PLOR refinement 3.851 ? 4 X-PLOR phasing 3.851 ? 5 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 353 ? ? 1_555 O A HOH 353 ? ? 10_666 1.21 2 1 O A HOH 414 ? ? 1_555 O A HOH 414 ? ? 11_555 1.77 3 1 O A HOH 413 ? ? 1_555 O A HOH 413 ? ? 11_555 1.85 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 16 ? ? -124.01 -67.09 2 1 VAL A 21 ? ? -121.20 -73.32 3 1 CYS A 146 ? ? -168.11 94.51 4 1 MET A 191 ? ? -132.15 -79.30 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 440 440 ZN ZN A . C 3 HOH 1 301 301 HOH HOH A . C 3 HOH 2 302 302 HOH HOH A . C 3 HOH 3 303 303 HOH HOH A . C 3 HOH 4 304 304 HOH HOH A . C 3 HOH 5 305 305 HOH HOH A . C 3 HOH 6 306 306 HOH HOH A . C 3 HOH 7 307 307 HOH HOH A . C 3 HOH 8 308 308 HOH HOH A . C 3 HOH 9 309 309 HOH HOH A . C 3 HOH 10 310 310 HOH HOH A . C 3 HOH 11 311 311 HOH HOH A . C 3 HOH 12 312 312 HOH HOH A . C 3 HOH 13 313 313 HOH HOH A . C 3 HOH 14 314 314 HOH HOH A . C 3 HOH 15 315 315 HOH HOH A . C 3 HOH 16 316 316 HOH HOH A . C 3 HOH 17 317 317 HOH HOH A . C 3 HOH 18 318 318 HOH HOH A . C 3 HOH 19 319 319 HOH HOH A . C 3 HOH 20 320 320 HOH HOH A . C 3 HOH 21 321 321 HOH HOH A . C 3 HOH 22 322 322 HOH HOH A . C 3 HOH 23 323 323 HOH HOH A . C 3 HOH 24 324 324 HOH HOH A . C 3 HOH 25 325 325 HOH HOH A . C 3 HOH 26 326 326 HOH HOH A . C 3 HOH 27 327 327 HOH HOH A . C 3 HOH 28 328 328 HOH HOH A . C 3 HOH 29 329 329 HOH HOH A . C 3 HOH 30 330 330 HOH HOH A . C 3 HOH 31 331 331 HOH HOH A . C 3 HOH 32 332 332 HOH HOH A . C 3 HOH 33 333 333 HOH HOH A . C 3 HOH 34 334 334 HOH HOH A . C 3 HOH 35 335 335 HOH HOH A . C 3 HOH 36 336 336 HOH HOH A . C 3 HOH 37 337 337 HOH HOH A . C 3 HOH 38 338 338 HOH HOH A . C 3 HOH 39 339 339 HOH HOH A . C 3 HOH 40 340 340 HOH HOH A . C 3 HOH 41 341 341 HOH HOH A . C 3 HOH 42 342 342 HOH HOH A . C 3 HOH 43 343 343 HOH HOH A . C 3 HOH 44 344 344 HOH HOH A . C 3 HOH 45 345 345 HOH HOH A . C 3 HOH 46 346 346 HOH HOH A . C 3 HOH 47 347 347 HOH HOH A . C 3 HOH 48 348 348 HOH HOH A . C 3 HOH 49 349 349 HOH HOH A . C 3 HOH 50 350 350 HOH HOH A . C 3 HOH 51 351 351 HOH HOH A . C 3 HOH 52 352 352 HOH HOH A . C 3 HOH 53 353 353 HOH HOH A . C 3 HOH 54 354 354 HOH HOH A . C 3 HOH 55 355 355 HOH HOH A . C 3 HOH 56 356 356 HOH HOH A . C 3 HOH 57 357 357 HOH HOH A . C 3 HOH 58 358 358 HOH HOH A . C 3 HOH 59 359 359 HOH HOH A . C 3 HOH 60 360 360 HOH HOH A . C 3 HOH 61 361 361 HOH HOH A . C 3 HOH 62 362 362 HOH HOH A . C 3 HOH 63 363 363 HOH HOH A . C 3 HOH 64 364 364 HOH HOH A . C 3 HOH 65 365 365 HOH HOH A . C 3 HOH 66 366 366 HOH HOH A . C 3 HOH 67 367 367 HOH HOH A . C 3 HOH 68 368 368 HOH HOH A . C 3 HOH 69 369 369 HOH HOH A . C 3 HOH 70 370 370 HOH HOH A . C 3 HOH 71 371 371 HOH HOH A . C 3 HOH 72 372 372 HOH HOH A . C 3 HOH 73 373 373 HOH HOH A . C 3 HOH 74 374 374 HOH HOH A . C 3 HOH 75 375 375 HOH HOH A . C 3 HOH 76 376 376 HOH HOH A . C 3 HOH 77 377 377 HOH HOH A . C 3 HOH 78 378 378 HOH HOH A . C 3 HOH 79 379 379 HOH HOH A . C 3 HOH 80 380 380 HOH HOH A . C 3 HOH 81 381 381 HOH HOH A . C 3 HOH 82 382 382 HOH HOH A . C 3 HOH 83 383 383 HOH HOH A . C 3 HOH 84 384 384 HOH HOH A . C 3 HOH 85 385 385 HOH HOH A . C 3 HOH 86 386 386 HOH HOH A . C 3 HOH 87 387 387 HOH HOH A . C 3 HOH 88 388 388 HOH HOH A . C 3 HOH 89 389 389 HOH HOH A . C 3 HOH 90 390 390 HOH HOH A . C 3 HOH 91 391 391 HOH HOH A . C 3 HOH 92 392 392 HOH HOH A . C 3 HOH 93 393 393 HOH HOH A . C 3 HOH 94 394 394 HOH HOH A . C 3 HOH 95 395 395 HOH HOH A . C 3 HOH 96 396 396 HOH HOH A . C 3 HOH 97 397 397 HOH HOH A . C 3 HOH 98 398 398 HOH HOH A . C 3 HOH 99 399 399 HOH HOH A . C 3 HOH 100 400 400 HOH HOH A . C 3 HOH 101 401 401 HOH HOH A . C 3 HOH 102 402 402 HOH HOH A . C 3 HOH 103 403 403 HOH HOH A . C 3 HOH 104 404 404 HOH HOH A . C 3 HOH 105 405 405 HOH HOH A . C 3 HOH 106 406 406 HOH HOH A . C 3 HOH 107 407 407 HOH HOH A . C 3 HOH 108 408 408 HOH HOH A . C 3 HOH 109 409 409 HOH HOH A . C 3 HOH 110 410 410 HOH HOH A . C 3 HOH 111 411 411 HOH HOH A . C 3 HOH 112 412 412 HOH HOH A . C 3 HOH 113 413 413 HOH HOH A . C 3 HOH 114 414 414 HOH HOH A . C 3 HOH 115 415 415 HOH HOH A . C 3 HOH 116 416 416 HOH HOH A . C 3 HOH 117 417 417 HOH HOH A . C 3 HOH 118 418 418 HOH HOH A . C 3 HOH 119 419 419 HOH HOH A . C 3 HOH 120 420 420 HOH HOH A . C 3 HOH 121 421 421 HOH HOH A . C 3 HOH 122 422 422 HOH HOH A . C 3 HOH 123 423 423 HOH HOH A . C 3 HOH 124 424 424 HOH HOH A . C 3 HOH 125 425 425 HOH HOH A . C 3 HOH 126 426 426 HOH HOH A . C 3 HOH 127 427 427 HOH HOH A . C 3 HOH 128 428 428 HOH HOH A . C 3 HOH 129 429 429 HOH HOH A . C 3 HOH 130 430 430 HOH HOH A . C 3 HOH 131 431 431 HOH HOH A . C 3 HOH 132 432 432 HOH HOH A . C 3 HOH 133 433 433 HOH HOH A . C 3 HOH 134 434 434 HOH HOH A . C 3 HOH 135 435 435 HOH HOH A . C 3 HOH 136 436 436 HOH HOH A . C 3 HOH 137 437 437 HOH HOH A . C 3 HOH 138 438 438 HOH HOH A . C 3 HOH 139 439 439 HOH HOH A . #