data_1AJH # _entry.id 1AJH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AJH pdb_00001ajh 10.2210/pdb1ajh/pdb WWPDB D_1000170892 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AJH _pdbx_database_status.recvd_initial_deposition_date 1997-05-02 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Teng, T.Y.' 1 'Srajer, V.' 2 'Moffat, K.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Photolysis-induced structural changes in single crystals of carbonmonoxy myoglobin at 40 K.' Nat.Struct.Biol. 1 701 705 1994 NSBIEW US 1072-8368 2024 ? 7634074 10.1038/nsb1094-701 1 'Initial Trajectory of Carbon Monoxide After Photodissociation from Myoglobin at Cryogenic Temperatures' Biochemistry 36 12087 ? 1997 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Teng, T.Y.' 1 ? primary 'Srajer, V.' 2 ? primary 'Moffat, K.' 3 ? 1 'Teng, T.Y.' 4 ? 1 'Srajer, V.' 5 ? 1 'Moffat, K.' 6 ? # _cell.entry_id 1AJH _cell.length_a 63.450 _cell.length_b 30.440 _cell.length_c 34.130 _cell.angle_alpha 90.00 _cell.angle_beta 105.70 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AJH _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat MYOGLOBIN 17234.951 1 ? ? ? 'CARBONMONOXY MYOGLOBIN, PHOTODISSOCIATED CO MOLECULE IS NOT BOUND TO THE HEME, HEME BOUND TO NE2 OF HIS 93' 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 4 non-polymer syn 'CARBON MONOXIDE' 28.010 1 ? ? ? ? 5 water nat water 18.015 183 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_seq_one_letter_code_can ;VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 LEU n 1 3 SER n 1 4 GLU n 1 5 GLY n 1 6 GLU n 1 7 TRP n 1 8 GLN n 1 9 LEU n 1 10 VAL n 1 11 LEU n 1 12 HIS n 1 13 VAL n 1 14 TRP n 1 15 ALA n 1 16 LYS n 1 17 VAL n 1 18 GLU n 1 19 ALA n 1 20 ASP n 1 21 VAL n 1 22 ALA n 1 23 GLY n 1 24 HIS n 1 25 GLY n 1 26 GLN n 1 27 ASP n 1 28 ILE n 1 29 LEU n 1 30 ILE n 1 31 ARG n 1 32 LEU n 1 33 PHE n 1 34 LYS n 1 35 SER n 1 36 HIS n 1 37 PRO n 1 38 GLU n 1 39 THR n 1 40 LEU n 1 41 GLU n 1 42 LYS n 1 43 PHE n 1 44 ASP n 1 45 ARG n 1 46 PHE n 1 47 LYS n 1 48 HIS n 1 49 LEU n 1 50 LYS n 1 51 THR n 1 52 GLU n 1 53 ALA n 1 54 GLU n 1 55 MET n 1 56 LYS n 1 57 ALA n 1 58 SER n 1 59 GLU n 1 60 ASP n 1 61 LEU n 1 62 LYS n 1 63 LYS n 1 64 HIS n 1 65 GLY n 1 66 VAL n 1 67 THR n 1 68 VAL n 1 69 LEU n 1 70 THR n 1 71 ALA n 1 72 LEU n 1 73 GLY n 1 74 ALA n 1 75 ILE n 1 76 LEU n 1 77 LYS n 1 78 LYS n 1 79 LYS n 1 80 GLY n 1 81 HIS n 1 82 HIS n 1 83 GLU n 1 84 ALA n 1 85 GLU n 1 86 LEU n 1 87 LYS n 1 88 PRO n 1 89 LEU n 1 90 ALA n 1 91 GLN n 1 92 SER n 1 93 HIS n 1 94 ALA n 1 95 THR n 1 96 LYS n 1 97 HIS n 1 98 LYS n 1 99 ILE n 1 100 PRO n 1 101 ILE n 1 102 LYS n 1 103 TYR n 1 104 LEU n 1 105 GLU n 1 106 PHE n 1 107 ILE n 1 108 SER n 1 109 GLU n 1 110 ALA n 1 111 ILE n 1 112 ILE n 1 113 HIS n 1 114 VAL n 1 115 LEU n 1 116 HIS n 1 117 SER n 1 118 ARG n 1 119 HIS n 1 120 PRO n 1 121 GLY n 1 122 ASP n 1 123 PHE n 1 124 GLY n 1 125 ALA n 1 126 ASP n 1 127 ALA n 1 128 GLN n 1 129 GLY n 1 130 ALA n 1 131 MET n 1 132 ASN n 1 133 LYS n 1 134 ALA n 1 135 LEU n 1 136 GLU n 1 137 LEU n 1 138 PHE n 1 139 ARG n 1 140 LYS n 1 141 ASP n 1 142 ILE n 1 143 ALA n 1 144 ALA n 1 145 LYS n 1 146 TYR n 1 147 LYS n 1 148 GLU n 1 149 LEU n 1 150 GLY n 1 151 TYR n 1 152 GLN n 1 153 GLY n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'sperm whale' _entity_src_nat.pdbx_organism_scientific 'Physeter catodon' _entity_src_nat.pdbx_ncbi_taxonomy_id 9755 _entity_src_nat.genus Physeter _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYG_PHYCA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02185 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AJH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02185 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 153 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CMO non-polymer . 'CARBON MONOXIDE' ? 'C O' 28.010 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1AJH _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.84 _exptl_crystal.density_percent_sol 33.17 _exptl_crystal.description ;THE CRYSTAL WAS ILLUMINATED BY A HE-NE LASER FOR 90 SECONDS BEFORE EACH X-RAY EXPOSURE. DATA WERE COLLECTED IN DARK USING AN OPEN FLOW NITROGEN/HELIUM CRYOSTAT FOR COOLING. ; # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'AS DESCRIBED IN KENDREW,J.C. AND PARRISH,R.G., PROC. ROY. SOC. A (LONDON) 238, 305-324 (1956), pH 6.0' # _diffrn.id 1 _diffrn.ambient_temp 40 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type FUJI _diffrn_detector.pdbx_collection_date 1993-06-30 _diffrn_detector.details YES # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator YES _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.123 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X26C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X26C _diffrn_source.pdbx_wavelength 1.123 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1AJH _reflns.observed_criterion_sigma_I 0. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 27.5 _reflns.d_resolution_high 1.69 _reflns.number_obs 13618 _reflns.number_all ? _reflns.percent_possible_obs 95.8 _reflns.pdbx_Rmerge_I_obs 0.0500000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 10.9 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.3 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.69 _reflns_shell.d_res_low 1.77 _reflns_shell.percent_possible_all 83.5 _reflns_shell.Rmerge_I_obs 0.1460000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.0 _reflns_shell.pdbx_redundancy 2.7 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1AJH _refine.ls_number_reflns_obs 13511 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 10000000.00 _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 1.69 _refine.ls_percent_reflns_obs 95.3 _refine.ls_R_factor_obs 0.1710000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1710000 _refine.ls_R_factor_R_free 0.2340000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10. _refine.ls_number_reflns_R_free 1375 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details 'THE FOLLOWING RESIDUES HAVE BEEN MODELED WITH TWO CONFORMERS -- 4 GLU, 21 VAL, 26 GLN, 31 ARG, 61 LEU.' _refine.pdbx_starting_model 'PDB ENTRY 1KRN' _refine.pdbx_method_to_determine_struct 'DIFFERENCE FOURIER' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1AJH _refine_analyze.Luzzati_coordinate_error_obs 0.16 _refine_analyze.Luzzati_sigma_a_obs 0.08 _refine_analyze.Luzzati_d_res_low_obs 10.0 _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1217 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 45 _refine_hist.number_atoms_solvent 193 _refine_hist.number_atoms_total 1455 _refine_hist.d_res_high 1.69 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.014 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 18.8 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.5 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 1.69 _refine_ls_shell.d_res_low 1.77 _refine_ls_shell.number_reflns_R_work 1380 _refine_ls_shell.R_factor_R_work 0.2310000 _refine_ls_shell.percent_reflns_obs 87.4 _refine_ls_shell.R_factor_R_free 0.2590000 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 10. _refine_ls_shell.number_reflns_R_free 139 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHSCDX.PRO 'X-RAY DIFFRACTION' 2 PARHCSDX.HEME TOPHSCDX.HEME 'X-RAY DIFFRACTION' 3 PARAM19X.CO TOPH19X.CO 'X-RAY DIFFRACTION' 4 PARAM19X.H2O TOPH19X.H20 'X-RAY DIFFRACTION' # _struct.entry_id 1AJH _struct.title 'PHOTOPRODUCT OF CARBONMONOXY MYOGLOBIN AT 40 K' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AJH _struct_keywords.pdbx_keywords 'OXYGEN TRANSPORT' _struct_keywords.text 'OXYGEN TRANSPORT, RESPIRATORY PROTEIN, HEME, PHOTOPRODUCT INTERMEDIATE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A SER A 3 ? GLU A 18 ? SER A 3 GLU A 18 1 ? 16 HELX_P HELX_P2 B ASP A 20 ? SER A 35 ? ASP A 20 SER A 35 2 ? 16 HELX_P HELX_P3 C HIS A 36 ? LYS A 42 ? HIS A 36 LYS A 42 3 ? 7 HELX_P HELX_P4 D THR A 51 ? ALA A 57 ? THR A 51 ALA A 57 4 ? 7 HELX_P HELX_P5 E SER A 58 ? LYS A 77 ? SER A 58 LYS A 77 5 ? 20 HELX_P HELX_P6 F LEU A 86 ? THR A 95 ? LEU A 86 THR A 95 6 ? 10 HELX_P HELX_P7 G PRO A 100 ? ARG A 118 ? PRO A 100 ARG A 118 7 ? 19 HELX_P HELX_P8 H GLY A 124 ? LEU A 149 ? GLY A 124 LEU A 149 8 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 93 NE2 ? ? ? 1_555 D HEM . FE ? ? A HIS 93 A HEM 154 1_555 ? ? ? ? ? ? ? 2.111 ? ? metalc2 metalc ? ? D HEM . FE ? ? ? 1_555 E CMO . C ? ? A HEM 154 A CMO 155 1_555 ? ? ? ? ? ? ? 2.846 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 156 ? 4 'BINDING SITE FOR RESIDUE SO4 A 156' AC2 Software A SO4 157 ? 4 'BINDING SITE FOR RESIDUE SO4 A 157' AC3 Software A HEM 154 ? 20 'BINDING SITE FOR RESIDUE HEM A 154' AC4 Software A CMO 155 ? 5 'BINDING SITE FOR RESIDUE CMO A 155' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 SER A 58 ? SER A 58 . ? 1_555 ? 2 AC1 4 GLU A 59 ? GLU A 59 . ? 1_555 ? 3 AC1 4 ASP A 60 ? ASP A 60 . ? 1_555 ? 4 AC1 4 HOH F . ? HOH A 400 . ? 1_555 ? 5 AC2 4 GLN A 26 ? GLN A 26 . ? 1_555 ? 6 AC2 4 LYS A 62 ? LYS A 62 . ? 1_555 ? 7 AC2 4 HOH F . ? HOH A 431 . ? 1_555 ? 8 AC2 4 HOH F . ? HOH A 432 . ? 1_555 ? 9 AC3 20 THR A 39 ? THR A 39 . ? 1_555 ? 10 AC3 20 LYS A 42 ? LYS A 42 . ? 1_555 ? 11 AC3 20 PHE A 43 ? PHE A 43 . ? 1_555 ? 12 AC3 20 ARG A 45 ? ARG A 45 . ? 1_555 ? 13 AC3 20 HIS A 64 ? HIS A 64 . ? 1_555 ? 14 AC3 20 THR A 67 ? THR A 67 . ? 1_555 ? 15 AC3 20 VAL A 68 ? VAL A 68 . ? 1_555 ? 16 AC3 20 ALA A 71 ? ALA A 71 . ? 1_555 ? 17 AC3 20 LEU A 89 ? LEU A 89 . ? 1_555 ? 18 AC3 20 SER A 92 ? SER A 92 . ? 1_555 ? 19 AC3 20 HIS A 93 ? HIS A 93 . ? 1_555 ? 20 AC3 20 HIS A 97 ? HIS A 97 . ? 1_555 ? 21 AC3 20 ILE A 99 ? ILE A 99 . ? 1_555 ? 22 AC3 20 TYR A 103 ? TYR A 103 . ? 1_555 ? 23 AC3 20 CMO E . ? CMO A 155 . ? 1_555 ? 24 AC3 20 HOH F . ? HOH A 315 . ? 1_555 ? 25 AC3 20 HOH F . ? HOH A 335 . ? 1_555 ? 26 AC3 20 HOH F . ? HOH A 371 . ? 1_555 ? 27 AC3 20 HOH F . ? HOH A 372 . ? 1_555 ? 28 AC3 20 HOH F . ? HOH A 424 . ? 1_555 ? 29 AC4 5 LEU A 29 ? LEU A 29 . ? 1_555 ? 30 AC4 5 PHE A 43 ? PHE A 43 . ? 1_555 ? 31 AC4 5 HIS A 64 ? HIS A 64 . ? 1_555 ? 32 AC4 5 VAL A 68 ? VAL A 68 . ? 1_555 ? 33 AC4 5 HEM D . ? HEM A 154 . ? 1_555 ? # _database_PDB_matrix.entry_id 1AJH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1AJH _atom_sites.fract_transf_matrix[1][1] 0.015760 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004430 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.032852 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.030435 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 GLY 153 153 153 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 156 156 SO4 SO4 A . C 2 SO4 1 157 157 SO4 SO4 A . D 3 HEM 1 154 154 HEM HEM A . E 4 CMO 1 155 155 CMO CMO A . F 5 HOH 1 300 300 HOH HOH A . F 5 HOH 2 303 303 HOH HOH A . F 5 HOH 3 304 304 HOH HOH A . F 5 HOH 4 305 305 HOH HOH A . F 5 HOH 5 306 306 HOH HOH A . F 5 HOH 6 307 307 HOH HOH A . F 5 HOH 7 308 308 HOH HOH A . F 5 HOH 8 309 309 HOH HOH A . F 5 HOH 9 310 310 HOH HOH A . F 5 HOH 10 312 312 HOH HOH A . F 5 HOH 11 314 314 HOH HOH A . F 5 HOH 12 315 315 HOH HOH A . F 5 HOH 13 320 320 HOH HOH A . F 5 HOH 14 321 321 HOH HOH A . F 5 HOH 15 322 322 HOH HOH A . F 5 HOH 16 323 323 HOH HOH A . F 5 HOH 17 324 324 HOH HOH A . F 5 HOH 18 325 325 HOH HOH A . F 5 HOH 19 326 326 HOH HOH A . F 5 HOH 20 327 327 HOH HOH A . F 5 HOH 21 328 328 HOH HOH A . F 5 HOH 22 329 329 HOH HOH A . F 5 HOH 23 330 330 HOH HOH A . F 5 HOH 24 331 331 HOH HOH A . F 5 HOH 25 332 332 HOH HOH A . F 5 HOH 26 333 333 HOH HOH A . F 5 HOH 27 334 334 HOH HOH A . F 5 HOH 28 335 335 HOH HOH A . F 5 HOH 29 336 336 HOH HOH A . F 5 HOH 30 337 337 HOH HOH A . F 5 HOH 31 338 338 HOH HOH A . F 5 HOH 32 339 339 HOH HOH A . F 5 HOH 33 340 340 HOH HOH A . F 5 HOH 34 342 342 HOH HOH A . F 5 HOH 35 343 343 HOH HOH A . F 5 HOH 36 344 344 HOH HOH A . F 5 HOH 37 345 345 HOH HOH A . F 5 HOH 38 346 346 HOH HOH A . F 5 HOH 39 351 351 HOH HOH A . F 5 HOH 40 352 352 HOH HOH A . F 5 HOH 41 353 353 HOH HOH A . F 5 HOH 42 354 354 HOH HOH A . F 5 HOH 43 355 355 HOH HOH A . F 5 HOH 44 356 356 HOH HOH A . F 5 HOH 45 357 357 HOH HOH A . F 5 HOH 46 358 358 HOH HOH A . F 5 HOH 47 359 359 HOH HOH A . F 5 HOH 48 360 360 HOH HOH A . F 5 HOH 49 363 363 HOH HOH A . F 5 HOH 50 364 364 HOH HOH A . F 5 HOH 51 365 365 HOH HOH A . F 5 HOH 52 366 366 HOH HOH A . F 5 HOH 53 367 367 HOH HOH A . F 5 HOH 54 368 368 HOH HOH A . F 5 HOH 55 369 369 HOH HOH A . F 5 HOH 56 370 370 HOH HOH A . F 5 HOH 57 371 371 HOH HOH A . F 5 HOH 58 372 372 HOH HOH A . F 5 HOH 59 374 374 HOH HOH A . F 5 HOH 60 377 377 HOH HOH A . F 5 HOH 61 378 378 HOH HOH A . F 5 HOH 62 379 379 HOH HOH A . F 5 HOH 63 380 380 HOH HOH A . F 5 HOH 64 381 381 HOH HOH A . F 5 HOH 65 382 382 HOH HOH A . F 5 HOH 66 384 384 HOH HOH A . F 5 HOH 67 386 386 HOH HOH A . F 5 HOH 68 387 387 HOH HOH A . F 5 HOH 69 388 388 HOH HOH A . F 5 HOH 70 389 389 HOH HOH A . F 5 HOH 71 390 390 HOH HOH A . F 5 HOH 72 391 391 HOH HOH A . F 5 HOH 73 393 393 HOH HOH A . F 5 HOH 74 395 395 HOH HOH A . F 5 HOH 75 397 397 HOH HOH A . F 5 HOH 76 398 398 HOH HOH A . F 5 HOH 77 399 399 HOH HOH A . F 5 HOH 78 400 400 HOH HOH A . F 5 HOH 79 401 401 HOH HOH A . F 5 HOH 80 402 402 HOH HOH A . F 5 HOH 81 404 404 HOH HOH A . F 5 HOH 82 405 405 HOH HOH A . F 5 HOH 83 407 407 HOH HOH A . F 5 HOH 84 408 408 HOH HOH A . F 5 HOH 85 409 409 HOH HOH A . F 5 HOH 86 410 410 HOH HOH A . F 5 HOH 87 411 411 HOH HOH A . F 5 HOH 88 413 413 HOH HOH A . F 5 HOH 89 414 414 HOH HOH A . F 5 HOH 90 416 416 HOH HOH A . F 5 HOH 91 417 417 HOH HOH A . F 5 HOH 92 418 418 HOH HOH A . F 5 HOH 93 419 419 HOH HOH A . F 5 HOH 94 420 420 HOH HOH A . F 5 HOH 95 421 421 HOH HOH A . F 5 HOH 96 422 422 HOH HOH A . F 5 HOH 97 423 423 HOH HOH A . F 5 HOH 98 424 424 HOH HOH A . F 5 HOH 99 426 426 HOH HOH A . F 5 HOH 100 427 427 HOH HOH A . F 5 HOH 101 428 428 HOH HOH A . F 5 HOH 102 430 430 HOH HOH A . F 5 HOH 103 431 431 HOH HOH A . F 5 HOH 104 432 432 HOH HOH A . F 5 HOH 105 433 433 HOH HOH A . F 5 HOH 106 435 435 HOH HOH A . F 5 HOH 107 436 436 HOH HOH A . F 5 HOH 108 437 437 HOH HOH A . F 5 HOH 109 438 438 HOH HOH A . F 5 HOH 110 440 440 HOH HOH A . F 5 HOH 111 441 441 HOH HOH A . F 5 HOH 112 442 442 HOH HOH A . F 5 HOH 113 443 443 HOH HOH A . F 5 HOH 114 445 445 HOH HOH A . F 5 HOH 115 448 448 HOH HOH A . F 5 HOH 116 449 449 HOH HOH A . F 5 HOH 117 450 450 HOH HOH A . F 5 HOH 118 451 451 HOH HOH A . F 5 HOH 119 452 452 HOH HOH A . F 5 HOH 120 453 453 HOH HOH A . F 5 HOH 121 454 454 HOH HOH A . F 5 HOH 122 455 455 HOH HOH A . F 5 HOH 123 456 456 HOH HOH A . F 5 HOH 124 457 457 HOH HOH A . F 5 HOH 125 458 458 HOH HOH A . F 5 HOH 126 459 459 HOH HOH A . F 5 HOH 127 460 460 HOH HOH A . F 5 HOH 128 461 461 HOH HOH A . F 5 HOH 129 462 462 HOH HOH A . F 5 HOH 130 463 463 HOH HOH A . F 5 HOH 131 464 464 HOH HOH A . F 5 HOH 132 465 465 HOH HOH A . F 5 HOH 133 466 466 HOH HOH A . F 5 HOH 134 467 467 HOH HOH A . F 5 HOH 135 468 468 HOH HOH A . F 5 HOH 136 469 469 HOH HOH A . F 5 HOH 137 471 471 HOH HOH A . F 5 HOH 138 472 472 HOH HOH A . F 5 HOH 139 475 475 HOH HOH A . F 5 HOH 140 476 476 HOH HOH A . F 5 HOH 141 478 478 HOH HOH A . F 5 HOH 142 479 479 HOH HOH A . F 5 HOH 143 480 480 HOH HOH A . F 5 HOH 144 481 481 HOH HOH A . F 5 HOH 145 482 482 HOH HOH A . F 5 HOH 146 483 483 HOH HOH A . F 5 HOH 147 485 485 HOH HOH A . F 5 HOH 148 488 488 HOH HOH A . F 5 HOH 149 489 489 HOH HOH A . F 5 HOH 150 490 490 HOH HOH A . F 5 HOH 151 492 492 HOH HOH A . F 5 HOH 152 494 494 HOH HOH A . F 5 HOH 153 495 495 HOH HOH A . F 5 HOH 154 496 496 HOH HOH A . F 5 HOH 155 497 497 HOH HOH A . F 5 HOH 156 498 498 HOH HOH A . F 5 HOH 157 499 499 HOH HOH A . F 5 HOH 158 500 500 HOH HOH A . F 5 HOH 159 501 501 HOH HOH A . F 5 HOH 160 502 502 HOH HOH A . F 5 HOH 161 504 504 HOH HOH A . F 5 HOH 162 505 505 HOH HOH A . F 5 HOH 163 507 507 HOH HOH A . F 5 HOH 164 508 508 HOH HOH A . F 5 HOH 165 510 510 HOH HOH A . F 5 HOH 166 511 511 HOH HOH A . F 5 HOH 167 512 512 HOH HOH A . F 5 HOH 168 513 513 HOH HOH A . F 5 HOH 169 514 514 HOH HOH A . F 5 HOH 170 515 515 HOH HOH A . F 5 HOH 171 516 516 HOH HOH A . F 5 HOH 172 517 517 HOH HOH A . F 5 HOH 173 518 518 HOH HOH A . F 5 HOH 174 519 519 HOH HOH A . F 5 HOH 175 520 520 HOH HOH A . F 5 HOH 176 521 521 HOH HOH A . F 5 HOH 177 522 522 HOH HOH A . F 5 HOH 178 525 525 HOH HOH A . F 5 HOH 179 526 526 HOH HOH A . F 5 HOH 180 528 528 HOH HOH A . F 5 HOH 181 529 529 HOH HOH A . F 5 HOH 182 530 530 HOH HOH A . F 5 HOH 183 531 531 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 NA ? D HEM . ? A HEM 154 ? 1_555 90.1 ? 2 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 NB ? D HEM . ? A HEM 154 ? 1_555 93.2 ? 3 NA ? D HEM . ? A HEM 154 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 NB ? D HEM . ? A HEM 154 ? 1_555 88.8 ? 4 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 NC ? D HEM . ? A HEM 154 ? 1_555 93.1 ? 5 NA ? D HEM . ? A HEM 154 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 NC ? D HEM . ? A HEM 154 ? 1_555 176.1 ? 6 NB ? D HEM . ? A HEM 154 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 NC ? D HEM . ? A HEM 154 ? 1_555 88.8 ? 7 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 ND ? D HEM . ? A HEM 154 ? 1_555 93.6 ? 8 NA ? D HEM . ? A HEM 154 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 ND ? D HEM . ? A HEM 154 ? 1_555 89.6 ? 9 NB ? D HEM . ? A HEM 154 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 ND ? D HEM . ? A HEM 154 ? 1_555 173.0 ? 10 NC ? D HEM . ? A HEM 154 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 ND ? D HEM . ? A HEM 154 ? 1_555 92.4 ? 11 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 C ? E CMO . ? A CMO 155 ? 1_555 159.7 ? 12 NA ? D HEM . ? A HEM 154 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 C ? E CMO . ? A CMO 155 ? 1_555 110.2 ? 13 NB ? D HEM . ? A HEM 154 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 C ? E CMO . ? A CMO 155 ? 1_555 86.3 ? 14 NC ? D HEM . ? A HEM 154 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 C ? E CMO . ? A CMO 155 ? 1_555 66.6 ? 15 ND ? D HEM . ? A HEM 154 ? 1_555 FE ? D HEM . ? A HEM 154 ? 1_555 C ? E CMO . ? A CMO 155 ? 1_555 87.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-11-12 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_initial_refinement_model 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 DENZO 'data reduction' . ? 3 CCP4 'data scaling' . ? 4 X-PLOR phasing . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 20 ? ? -151.64 69.60 2 1 HIS A 81 ? ? -90.54 59.11 3 1 HIS A 119 ? ? -141.46 51.68 4 1 GLN A 152 ? ? -45.77 105.69 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'PROTOPORPHYRIN IX CONTAINING FE' HEM 4 'CARBON MONOXIDE' CMO 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1KRN _pdbx_initial_refinement_model.details 'PDB ENTRY 1KRN' #