data_1AYB # _entry.id 1AYB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1AYB WWPDB D_1000171404 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AYB _pdbx_database_status.recvd_initial_deposition_date 1994-05-15 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, C.-H.' 1 'Kuriyan, J.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structures of peptide complexes of the amino-terminal SH2 domain of the Syp tyrosine phosphatase.' Structure 2 423 438 1994 STRUE6 UK 0969-2126 2005 ? 7521735 '10.1016/S0969-2126(00)00044-7' 1 'Binding of a High Affinity Phosphotyrosyl Peptide to the Src Sh2 Domain: Crystal Structures of the Complexed and Peptide-Free Forms' 'Cell(Cambridge,Mass.)' 72 779 ? 1993 CELLB5 US 0092-8674 0998 ? ? ? 2 'Structures of Sh2 and SH3 Domains' Curr.Opin.Struct.Biol. 3 828 ? 1993 COSBEF UK 0959-440X 0801 ? ? ? 3 'Crystal Structure of the Phosphotyrosine Recognition Domain Sh2 of V-Src Complexed with Tyrosine-Phosphorylated Peptides' Nature 358 646 ? 1992 NATUAS UK 0028-0836 0006 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lee, C.H.' 1 primary 'Kominos, D.' 2 primary 'Jacques, S.' 3 primary 'Margolis, B.' 4 primary 'Schlessinger, J.' 5 primary 'Shoelson, S.E.' 6 primary 'Kuriyan, J.' 7 1 'Waksman, G.' 8 1 'Shoelson, S.E.' 9 1 'Pant, N.' 10 1 'Cowburn, D.' 11 1 'Kuriyan, J.' 12 2 'Kuriyan, J.' 13 2 'Cowburn, D.' 14 3 'Waksman, G.' 15 3 'Kominos, D.' 16 3 'Robertson, S.R.' 17 3 'Pant, N.' 18 3 'Baltimore, D.' 19 3 'Birge, R.B.' 20 3 'Cowburn, D.' 21 3 'Hanafusa, H.' 22 3 'Mayer, B.J.' 23 3 'Overduin, M.' 24 3 'Resh, M.D.' 25 3 'Rios, C.B.' 26 3 'Silverman, L.' 27 3 'Kuriyan, J.' 28 # _cell.entry_id 1AYB _cell.length_a 62.900 _cell.length_b 62.900 _cell.length_c 77.800 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AYB _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN-TYROSINE PHOSPHATASE SYP (N-TERMINAL SH2 DOMAIN)' 11528.979 1 3.1.3.48 ? ? ? 2 polymer man 'PEPTIDE IRS-1-895' 1378.335 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYM EHHGQLKEKNGDVIELKYPLN ; ;MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYM EHHGQLKEKNGDVIELKYPLN ; A ? 2 'polypeptide(L)' no yes 'SPGE(PTR)VNIEFGS' SPGEYVNIEFGS P ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ARG n 1 4 TRP n 1 5 PHE n 1 6 HIS n 1 7 PRO n 1 8 ASN n 1 9 ILE n 1 10 THR n 1 11 GLY n 1 12 VAL n 1 13 GLU n 1 14 ALA n 1 15 GLU n 1 16 ASN n 1 17 LEU n 1 18 LEU n 1 19 LEU n 1 20 THR n 1 21 ARG n 1 22 GLY n 1 23 VAL n 1 24 ASP n 1 25 GLY n 1 26 SER n 1 27 PHE n 1 28 LEU n 1 29 ALA n 1 30 ARG n 1 31 PRO n 1 32 SER n 1 33 LYS n 1 34 SER n 1 35 ASN n 1 36 PRO n 1 37 GLY n 1 38 ASP n 1 39 PHE n 1 40 THR n 1 41 LEU n 1 42 SER n 1 43 VAL n 1 44 ARG n 1 45 ARG n 1 46 ASN n 1 47 GLY n 1 48 ALA n 1 49 VAL n 1 50 THR n 1 51 HIS n 1 52 ILE n 1 53 LYS n 1 54 ILE n 1 55 GLN n 1 56 ASN n 1 57 THR n 1 58 GLY n 1 59 ASP n 1 60 TYR n 1 61 TYR n 1 62 ASP n 1 63 LEU n 1 64 TYR n 1 65 GLY n 1 66 GLY n 1 67 GLU n 1 68 LYS n 1 69 PHE n 1 70 ALA n 1 71 THR n 1 72 LEU n 1 73 ALA n 1 74 GLU n 1 75 LEU n 1 76 VAL n 1 77 GLN n 1 78 TYR n 1 79 TYR n 1 80 MET n 1 81 GLU n 1 82 HIS n 1 83 HIS n 1 84 GLY n 1 85 GLN n 1 86 LEU n 1 87 LYS n 1 88 GLU n 1 89 LYS n 1 90 ASN n 1 91 GLY n 1 92 ASP n 1 93 VAL n 1 94 ILE n 1 95 GLU n 1 96 LEU n 1 97 LYS n 1 98 TYR n 1 99 PRO n 1 100 LEU n 1 101 ASN n 2 1 SER n 2 2 PRO n 2 3 GLY n 2 4 GLU n 2 5 PTR n 2 6 VAL n 2 7 ASN n 2 8 ILE n 2 9 GLU n 2 10 PHE n 2 11 GLY n 2 12 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 UNP PTN11_MOUSE 1 P35235 1 ;MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQY YMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGES NDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNN SKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRE LKLSKVGQALLQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILI DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSGELGYTET RVGCPGHSVSPMDEVDGGWVEGLGT ; ? 2 UNP IRS1_MOUSE 2 P35569 1 ;MASPPDTDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAPKRSIPLESCFNINKRADSKN KHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKAHHDGAGGGCGGSCSGSSGVGEAGEDLSYDTGPGPAFKEVWQ VILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVV AQNMHETILEAMRAMSDEFRPRSKSQSSSSCSNPISVPLRRHHLNNPPPSQVGLTRRSRTESITATSPASMVGGKPGSFR VRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHRGSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSD CLFPRRSSASVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLAAPNGHYIL SRGGNGHRYIPGANLGTSPALPGDEAAGAADLDNRFRKRTHSAGTSPTISHQKTPSQSSVASIEEYTEMMPAAYPPGGGS GGRLPGYRHSAFVPTHSYPEEGLEMHHLERRGGHHRPDTSNLHTDDGYMPMSPGVAPVPSNRKGNGDYMPMSPKSVSAPQ QIINPIRRHPQRVDPNGYMMMSPSGSCSPDIGGGSSSSSSISAAPSGSSYGKPWTNGVGGHHTHALPHAKPPVESGGGKL LPCTGDYMNMSPVGDSNTSSPSECYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEPEEGARHQHLRLSSSSGRLRYTATAE DSSSSTSSDSLGGGYCGARPESSLTHPHHHVLQPHLPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRVREQQQQQQSSL HPPEPKSPGEYVNIEFGSGQPGYLAGPATSRSSPSVRCPPQLHPAPREETGSEEYMNMDLGPGRRATWQESGGVELGRIG PAPPGSATVCRPTRSVPNSRGDYMTMQIGCPRQSYVDTSPVAPVSYADMRTGIAAEKASLPRPTGAAPPPSSTASSSASV TPQGATAEQATHSSLLGGPQGPGGMSAFTRVNLSPNHNQSAKVIRADTQGCRRRHSSETFSAPTRAGNTVPFGAGAAVGG SGGGGGGGSEDVKRHSSASFENVWLRPGDLGGVSKESAPVCGAAGGLEKSLNYIDLDLAKEHSQDCPSQQQSLPPPPPHQ PLGSNEGNSPRRSSEDLSNYASISFQKQPEDRQ ; ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1AYB A 2 ? 101 ? P35235 4 ? 103 ? 4 103 2 2 1AYB P 1 ? 12 ? P35569 887 ? 898 ? -4 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1AYB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.98 _exptl_crystal.density_percent_sol 58.72 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1AYB _refine.ls_number_reflns_obs 1858 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.0 _refine.ls_d_res_high 3.0 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.164 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.164 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 850 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 854 _refine_hist.d_res_high 3.0 _refine_hist.d_res_low 6.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.014 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 3.0 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1AYB _struct.title 'CRYSTAL STRUCTURES OF PEPTIDE COMPLEXES OF THE AMINO-TERMINAL SH2 DOMAIN OF THE SYP TYROSINE PHOSPHATASE' _struct.pdbx_descriptor 'TYROSINE PHOSPHATASE SYP (N-TERMINAL SH2 DOMAIN) (PTP1D, SHPTP2) (E.C.3.1.3.48) COMPLEXED WITH THE PEPTIDE IRS-1-895' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AYB _struct_keywords.pdbx_keywords 'HYDROLASE(SH2 DOMAIN)' _struct_keywords.text 'HYDROLASE(SH2 DOMAIN)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 10 ? ARG A 21 ? THR A 12 ARG A 23 1 ? 12 HELX_P HELX_P2 2 THR A 71 ? HIS A 82 ? THR A 73 HIS A 84 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? B GLU 4 C ? ? ? 1_555 B PTR 5 N ? ? P GLU -1 P PTR 0 1_555 ? ? ? ? ? ? ? 1.338 ? covale2 covale ? ? B PTR 5 C ? ? ? 1_555 B VAL 6 N ? ? P PTR 0 P VAL 1 1_555 ? ? ? ? ? ? ? 1.318 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 98 ? PRO A 99 ? TYR A 100 PRO A 101 A 2 SER A 26 ? PRO A 31 ? SER A 28 PRO A 33 A 3 PHE A 39 ? ARG A 45 ? PHE A 41 ARG A 47 A 4 ALA A 48 ? ASN A 56 ? ALA A 50 ASN A 58 A 5 TYR A 61 ? ASP A 62 ? TYR A 63 ASP A 64 B 1 TYR A 98 ? PRO A 99 ? TYR A 100 PRO A 101 B 2 SER A 26 ? PRO A 31 ? SER A 28 PRO A 33 B 3 PHE A 39 ? ARG A 45 ? PHE A 41 ARG A 47 B 4 ALA A 48 ? ASN A 56 ? ALA A 50 ASN A 58 C 1 LYS A 87 ? GLU A 88 ? LYS A 89 GLU A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 98 ? O TYR A 100 N PHE A 27 ? N PHE A 29 A 2 3 O ARG A 30 ? O ARG A 32 N THR A 40 ? N THR A 42 A 3 4 N ARG A 45 ? N ARG A 47 O ALA A 48 ? O ALA A 50 A 4 5 N GLN A 55 ? N GLN A 57 O ASP A 62 ? O ASP A 64 B 1 2 O TYR A 98 ? O TYR A 100 N PHE A 27 ? N PHE A 29 B 2 3 O ARG A 30 ? O ARG A 32 N THR A 40 ? N THR A 42 B 3 4 N ARG A 45 ? N ARG A 47 O ALA A 48 ? O ALA A 50 # _database_PDB_matrix.entry_id 1AYB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1AYB _atom_sites.fract_transf_matrix[1][1] 0.015898 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015898 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012853 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 3 ? ? ? A . n A 1 2 ARG 2 4 4 ARG ARG A . n A 1 3 ARG 3 5 5 ARG ARG A . n A 1 4 TRP 4 6 6 TRP TRP A . n A 1 5 PHE 5 7 7 PHE PHE A . n A 1 6 HIS 6 8 8 HIS HIS A . n A 1 7 PRO 7 9 9 PRO PRO A . n A 1 8 ASN 8 10 10 ASN ASN A . n A 1 9 ILE 9 11 11 ILE ILE A . n A 1 10 THR 10 12 12 THR THR A . n A 1 11 GLY 11 13 13 GLY GLY A . n A 1 12 VAL 12 14 14 VAL VAL A . n A 1 13 GLU 13 15 15 GLU GLU A . n A 1 14 ALA 14 16 16 ALA ALA A . n A 1 15 GLU 15 17 17 GLU GLU A . n A 1 16 ASN 16 18 18 ASN ASN A . n A 1 17 LEU 17 19 19 LEU LEU A . n A 1 18 LEU 18 20 20 LEU LEU A . n A 1 19 LEU 19 21 21 LEU LEU A . n A 1 20 THR 20 22 22 THR THR A . n A 1 21 ARG 21 23 23 ARG ARG A . n A 1 22 GLY 22 24 24 GLY GLY A . n A 1 23 VAL 23 25 25 VAL VAL A . n A 1 24 ASP 24 26 26 ASP ASP A . n A 1 25 GLY 25 27 27 GLY GLY A . n A 1 26 SER 26 28 28 SER SER A . n A 1 27 PHE 27 29 29 PHE PHE A . n A 1 28 LEU 28 30 30 LEU LEU A . n A 1 29 ALA 29 31 31 ALA ALA A . n A 1 30 ARG 30 32 32 ARG ARG A . n A 1 31 PRO 31 33 33 PRO PRO A . n A 1 32 SER 32 34 34 SER SER A . n A 1 33 LYS 33 35 35 LYS LYS A . n A 1 34 SER 34 36 36 SER SER A . n A 1 35 ASN 35 37 37 ASN ASN A . n A 1 36 PRO 36 38 38 PRO PRO A . n A 1 37 GLY 37 39 39 GLY GLY A . n A 1 38 ASP 38 40 40 ASP ASP A . n A 1 39 PHE 39 41 41 PHE PHE A . n A 1 40 THR 40 42 42 THR THR A . n A 1 41 LEU 41 43 43 LEU LEU A . n A 1 42 SER 42 44 44 SER SER A . n A 1 43 VAL 43 45 45 VAL VAL A . n A 1 44 ARG 44 46 46 ARG ARG A . n A 1 45 ARG 45 47 47 ARG ARG A . n A 1 46 ASN 46 48 48 ASN ASN A . n A 1 47 GLY 47 49 49 GLY GLY A . n A 1 48 ALA 48 50 50 ALA ALA A . n A 1 49 VAL 49 51 51 VAL VAL A . n A 1 50 THR 50 52 52 THR THR A . n A 1 51 HIS 51 53 53 HIS HIS A . n A 1 52 ILE 52 54 54 ILE ILE A . n A 1 53 LYS 53 55 55 LYS LYS A . n A 1 54 ILE 54 56 56 ILE ILE A . n A 1 55 GLN 55 57 57 GLN GLN A . n A 1 56 ASN 56 58 58 ASN ASN A . n A 1 57 THR 57 59 59 THR THR A . n A 1 58 GLY 58 60 60 GLY GLY A . n A 1 59 ASP 59 61 61 ASP ASP A . n A 1 60 TYR 60 62 62 TYR TYR A . n A 1 61 TYR 61 63 63 TYR TYR A . n A 1 62 ASP 62 64 64 ASP ASP A . n A 1 63 LEU 63 65 65 LEU LEU A . n A 1 64 TYR 64 66 66 TYR TYR A . n A 1 65 GLY 65 67 67 GLY GLY A . n A 1 66 GLY 66 68 68 GLY GLY A . n A 1 67 GLU 67 69 69 GLU GLU A . n A 1 68 LYS 68 70 70 LYS LYS A . n A 1 69 PHE 69 71 71 PHE PHE A . n A 1 70 ALA 70 72 72 ALA ALA A . n A 1 71 THR 71 73 73 THR THR A . n A 1 72 LEU 72 74 74 LEU LEU A . n A 1 73 ALA 73 75 75 ALA ALA A . n A 1 74 GLU 74 76 76 GLU GLU A . n A 1 75 LEU 75 77 77 LEU LEU A . n A 1 76 VAL 76 78 78 VAL VAL A . n A 1 77 GLN 77 79 79 GLN GLN A . n A 1 78 TYR 78 80 80 TYR TYR A . n A 1 79 TYR 79 81 81 TYR TYR A . n A 1 80 MET 80 82 82 MET MET A . n A 1 81 GLU 81 83 83 GLU GLU A . n A 1 82 HIS 82 84 84 HIS HIS A . n A 1 83 HIS 83 85 85 HIS HIS A . n A 1 84 GLY 84 86 86 GLY GLY A . n A 1 85 GLN 85 87 87 GLN GLN A . n A 1 86 LEU 86 88 88 LEU LEU A . n A 1 87 LYS 87 89 89 LYS LYS A . n A 1 88 GLU 88 90 90 GLU GLU A . n A 1 89 LYS 89 91 91 LYS LYS A . n A 1 90 ASN 90 92 92 ASN ASN A . n A 1 91 GLY 91 93 93 GLY GLY A . n A 1 92 ASP 92 94 94 ASP ASP A . n A 1 93 VAL 93 95 95 VAL VAL A . n A 1 94 ILE 94 96 96 ILE ILE A . n A 1 95 GLU 95 97 97 GLU GLU A . n A 1 96 LEU 96 98 98 LEU LEU A . n A 1 97 LYS 97 99 99 LYS LYS A . n A 1 98 TYR 98 100 100 TYR TYR A . n A 1 99 PRO 99 101 101 PRO PRO A . n A 1 100 LEU 100 102 102 LEU LEU A . n A 1 101 ASN 101 103 103 ASN ASN A . n B 2 1 SER 1 -4 ? ? ? P . n B 2 2 PRO 2 -3 ? ? ? P . n B 2 3 GLY 3 -2 -2 GLY GLY P . n B 2 4 GLU 4 -1 -1 GLU GLU P . n B 2 5 PTR 5 0 0 PTR TYR P . n B 2 6 VAL 6 1 1 VAL VAL P . n B 2 7 ASN 7 2 2 ASN ASN P . n B 2 8 ILE 8 3 3 ILE ILE P . n B 2 9 GLU 9 4 4 GLU GLU P . n B 2 10 PHE 10 5 5 PHE PHE P . n B 2 11 GLY 11 6 ? ? ? P . n B 2 12 SER 12 7 ? ? ? P . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 5 _pdbx_struct_mod_residue.auth_asym_id P _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 0 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1190 ? 1 MORE -13 ? 1 'SSA (A^2)' 5830 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-08-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 8 ? ? CD2 A HIS 8 ? ? 1.301 1.373 -0.072 0.011 N 2 1 NE2 A HIS 53 ? ? CD2 A HIS 53 ? ? 1.297 1.373 -0.076 0.011 N 3 1 NE2 A HIS 84 ? ? CD2 A HIS 84 ? ? 1.299 1.373 -0.074 0.011 N 4 1 NE2 A HIS 85 ? ? CD2 A HIS 85 ? ? 1.306 1.373 -0.067 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CD1 A TRP 6 ? ? CG A TRP 6 ? ? CD2 A TRP 6 ? ? 111.12 106.30 4.82 0.80 N 2 1 CE2 A TRP 6 ? ? CD2 A TRP 6 ? ? CG A TRP 6 ? ? 101.02 107.30 -6.28 0.80 N 3 1 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH1 A ARG 23 ? ? 124.96 120.30 4.66 0.50 N 4 1 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH2 A ARG 23 ? ? 116.50 120.30 -3.80 0.50 N 5 1 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.95 120.30 3.65 0.50 N 6 1 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH2 A ARG 32 ? ? 116.87 120.30 -3.43 0.50 N 7 1 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH2 A ARG 46 ? ? 116.77 120.30 -3.53 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 5 ? ? -65.73 12.38 2 1 LEU A 65 ? ? -107.55 53.70 3 1 HIS A 84 ? ? -102.88 79.37 4 1 LYS A 91 ? ? -55.37 99.08 5 1 LEU A 98 ? ? -100.23 72.62 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 4 ? NE ? A ARG 2 NE 2 1 Y 1 A ARG 4 ? CZ ? A ARG 2 CZ 3 1 Y 1 A ARG 4 ? NH1 ? A ARG 2 NH1 4 1 Y 1 A ARG 4 ? NH2 ? A ARG 2 NH2 5 1 Y 1 A ARG 5 ? CG ? A ARG 3 CG 6 1 Y 1 A ARG 5 ? CD ? A ARG 3 CD 7 1 Y 1 A ARG 5 ? NE ? A ARG 3 NE 8 1 Y 1 A ARG 5 ? CZ ? A ARG 3 CZ 9 1 Y 1 A ARG 5 ? NH1 ? A ARG 3 NH1 10 1 Y 1 A ARG 5 ? NH2 ? A ARG 3 NH2 11 1 Y 1 A LYS 35 ? CG ? A LYS 33 CG 12 1 Y 1 A LYS 35 ? CD ? A LYS 33 CD 13 1 Y 1 A LYS 35 ? CE ? A LYS 33 CE 14 1 Y 1 A LYS 35 ? NZ ? A LYS 33 NZ 15 1 Y 1 A GLU 90 ? CG ? A GLU 88 CG 16 1 Y 1 A GLU 90 ? CD ? A GLU 88 CD 17 1 Y 1 A GLU 90 ? OE1 ? A GLU 88 OE1 18 1 Y 1 A GLU 90 ? OE2 ? A GLU 88 OE2 19 1 Y 1 A ASN 92 ? CG ? A ASN 90 CG 20 1 Y 1 A ASN 92 ? OD1 ? A ASN 90 OD1 21 1 Y 1 A ASN 92 ? ND2 ? A ASN 90 ND2 22 1 Y 1 A ASP 94 ? CG ? A ASP 92 CG 23 1 Y 1 A ASP 94 ? OD1 ? A ASP 92 OD1 24 1 Y 1 A ASP 94 ? OD2 ? A ASP 92 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 3 ? A MET 1 2 1 Y 1 P SER -4 ? B SER 1 3 1 Y 1 P PRO -3 ? B PRO 2 4 1 Y 1 P GLY 6 ? B GLY 11 5 1 Y 1 P SER 7 ? B SER 12 #