data_1BA6 # _entry.id 1BA6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BA6 pdb_00001ba6 10.2210/pdb1ba6/pdb WWPDB D_1000171515 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BA6 _pdbx_database_status.recvd_initial_deposition_date 1998-04-22 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Watson, A.A.' 1 'Fairlie, D.P.' 2 'Craik, D.J.' 3 # _citation.id primary _citation.title 'Solution structure of methionine-oxidized amyloid beta-peptide (1-40). Does oxidation affect conformational switching?' _citation.journal_abbrev Biochemistry _citation.journal_volume 37 _citation.page_first 12700 _citation.page_last 12706 _citation.year 1998 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9737846 _citation.pdbx_database_id_DOI 10.1021/bi9810757 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Watson, A.A.' 1 ? primary 'Fairlie, D.P.' 2 ? primary 'Craik, D.J.' 3 ? # _cell.entry_id 1BA6 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BA6 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'AMYLOID BETA-PEPTIDE' _entity.formula_weight 4351.852 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'INS(MO)' _entity.pdbx_fragment ABETA _entity.details 'METHIONINE OXIDIZED' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL(SME)VGGVV' _entity_poly.pdbx_seq_one_letter_code_can DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ALA n 1 3 GLU n 1 4 PHE n 1 5 ARG n 1 6 HIS n 1 7 ASP n 1 8 SER n 1 9 GLY n 1 10 TYR n 1 11 GLU n 1 12 VAL n 1 13 HIS n 1 14 HIS n 1 15 GLN n 1 16 LYS n 1 17 LEU n 1 18 VAL n 1 19 PHE n 1 20 PHE n 1 21 ALA n 1 22 GLU n 1 23 ASP n 1 24 VAL n 1 25 GLY n 1 26 SER n 1 27 ASN n 1 28 LYS n 1 29 GLY n 1 30 ALA n 1 31 ILE n 1 32 ILE n 1 33 GLY n 1 34 LEU n 1 35 SME n 1 36 VAL n 1 37 GLY n 1 38 GLY n 1 39 VAL n 1 40 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name unidentified _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 32644 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A4_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P05067 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPEL QITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSE KSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFF YGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEA KHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQD EVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPV DARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BA6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05067 _struct_ref_seq.db_align_beg 672 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 711 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 40 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1BA6 _struct_ref_seq_dif.mon_id SME _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 35 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P05067 _struct_ref_seq_dif.db_mon_id MET _struct_ref_seq_dif.pdbx_seq_db_seq_num 706 _struct_ref_seq_dif.details 'modified residue' _struct_ref_seq_dif.pdbx_auth_seq_num 35 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SME 'L-peptide linking' n 'METHIONINE SULFOXIDE' ? 'C5 H11 N O3 S' 165.211 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 AMX-500 Bruker 500 2 DRX-750 Bruker 750 # _pdbx_nmr_refine.entry_id 1BA6 _pdbx_nmr_refine.method 'SIMULATED ANNEALING USING NOE DISTANCE CONSTRAINTS' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN JOURNAL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1BA6 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOW ENERGY, LOW VIOLATIONS' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR ? BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 1BA6 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1BA6 _struct.title ;SOLUTION STRUCTURE OF THE METHIONINE-OXIDIZED AMYLOID BETA-PEPTIDE (1-40). DOES OXIDATION AFFECT CONFORMATIONAL SWITCHING? NMR, 10 STRUCTURES ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BA6 _struct_keywords.pdbx_keywords GLYCOPROTEIN _struct_keywords.text ;GLYCOPROTEIN, OXIDIZED AMYLOID BETA-PEPTIDE, ALZHEIMER'S DISEASE, METHIONINE SULFOXIDE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 15 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 15 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 25 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 34 C ? ? ? 1_555 A SME 35 N ? ? A LEU 34 A SME 35 1_555 ? ? ? ? ? ? ? 1.306 ? ? covale2 covale both ? A SME 35 C ? ? ? 1_555 A VAL 36 N ? ? A SME 35 A VAL 36 1_555 ? ? ? ? ? ? ? 1.308 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1BA6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BA6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SME 35 35 35 SME SME A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SME _pdbx_struct_mod_residue.label_seq_id 35 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SME _pdbx_struct_mod_residue.auth_seq_id 35 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details 'METHIONINE SULFOXIDE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-06-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 3 ? ? -89.12 38.87 2 1 HIS A 6 ? ? -81.60 33.09 3 1 SER A 8 ? ? -65.85 -169.90 4 1 HIS A 14 ? ? -100.89 46.23 5 1 PHE A 20 ? ? -49.60 -8.72 6 1 SER A 26 ? ? -92.29 40.22 7 1 ASN A 27 ? ? -48.65 150.05 8 1 LYS A 28 ? ? -163.74 43.09 9 1 SME A 35 ? ? -165.39 32.71 10 1 VAL A 39 ? ? -97.14 34.24 11 2 ALA A 2 ? ? -170.44 62.83 12 2 HIS A 6 ? ? 38.97 37.87 13 2 ASP A 7 ? ? -49.02 98.17 14 2 SER A 8 ? ? -168.30 39.20 15 2 TYR A 10 ? ? -102.24 51.89 16 2 HIS A 14 ? ? -56.97 85.03 17 2 LYS A 16 ? ? 55.53 14.90 18 2 PHE A 20 ? ? -46.95 -17.73 19 2 SER A 26 ? ? -82.05 32.49 20 2 LYS A 28 ? ? -165.26 40.57 21 2 ALA A 30 ? ? -134.90 -45.30 22 3 ARG A 5 ? ? -83.90 -118.80 23 3 HIS A 6 ? ? 18.35 64.78 24 3 ASP A 7 ? ? -64.30 94.42 25 3 TYR A 10 ? ? -99.78 57.36 26 3 GLU A 11 ? ? -161.11 -68.09 27 3 HIS A 14 ? ? -87.11 37.60 28 3 GLN A 15 ? ? -135.88 -86.40 29 3 SER A 26 ? ? -94.21 52.64 30 3 LYS A 28 ? ? -165.95 42.05 31 3 ALA A 30 ? ? -161.51 -46.53 32 3 LEU A 34 ? ? 34.36 35.04 33 3 VAL A 39 ? ? -97.99 33.82 34 4 ALA A 2 ? ? -161.72 66.79 35 4 GLU A 3 ? ? 35.33 78.93 36 4 SER A 8 ? ? 67.14 124.02 37 4 TYR A 10 ? ? -147.86 -11.97 38 4 GLU A 11 ? ? -78.33 20.02 39 4 VAL A 12 ? ? -68.65 -178.25 40 4 HIS A 13 ? ? -106.97 47.29 41 4 HIS A 14 ? ? -47.53 91.26 42 4 GLN A 15 ? ? -179.57 -47.64 43 4 PHE A 20 ? ? -48.57 -16.06 44 4 LEU A 34 ? ? -165.50 101.56 45 5 ALA A 2 ? ? -172.00 105.85 46 5 ARG A 5 ? ? -169.68 53.18 47 5 VAL A 12 ? ? -59.74 173.88 48 5 HIS A 13 ? ? -141.36 55.87 49 5 GLN A 15 ? ? -91.63 -118.82 50 5 PHE A 20 ? ? -46.45 -19.17 51 5 SER A 26 ? ? -82.69 31.56 52 5 LEU A 34 ? ? -81.39 41.01 53 6 ALA A 2 ? ? -167.51 97.57 54 6 HIS A 6 ? ? -82.89 40.16 55 6 ASP A 7 ? ? 57.45 -166.79 56 6 SER A 8 ? ? 56.21 -166.28 57 6 TYR A 10 ? ? -107.14 44.40 58 6 HIS A 14 ? ? -85.30 42.05 59 6 LYS A 16 ? ? -71.97 -71.46 60 6 PHE A 20 ? ? -47.39 -19.90 61 6 SER A 26 ? ? -90.23 43.28 62 6 ALA A 30 ? ? -171.42 -58.81 63 6 LEU A 34 ? ? 33.54 48.49 64 6 SME A 35 ? ? 67.99 155.22 65 7 ARG A 5 ? ? 54.22 88.73 66 7 HIS A 6 ? ? -86.29 38.58 67 7 SER A 8 ? ? -170.94 142.99 68 7 TYR A 10 ? ? -145.37 -40.30 69 7 VAL A 12 ? ? 43.46 -151.45 70 7 GLN A 15 ? ? -169.55 -77.51 71 7 PHE A 20 ? ? -39.11 -31.37 72 7 SME A 35 ? ? -59.49 170.90 73 7 VAL A 39 ? ? 38.09 45.67 74 8 ALA A 2 ? ? 47.66 79.38 75 8 ARG A 5 ? ? -152.57 37.10 76 8 SER A 8 ? ? 60.75 -176.95 77 8 GLU A 11 ? ? -168.99 85.41 78 8 GLN A 15 ? ? -166.59 -57.69 79 8 ALA A 30 ? ? -166.49 -21.25 80 8 LEU A 34 ? ? 59.33 72.70 81 8 SME A 35 ? ? -157.18 73.61 82 8 VAL A 39 ? ? -89.23 30.18 83 9 HIS A 6 ? ? 39.81 37.53 84 9 ASP A 7 ? ? -165.71 118.08 85 9 SER A 8 ? ? -173.92 118.84 86 9 TYR A 10 ? ? -119.53 71.01 87 9 GLU A 11 ? ? -167.44 -28.05 88 9 HIS A 13 ? ? -99.69 40.22 89 9 HIS A 14 ? ? -62.53 80.89 90 9 LYS A 28 ? ? -164.97 40.26 91 9 ALA A 30 ? ? -150.83 -68.01 92 9 LEU A 34 ? ? 53.41 81.28 93 9 SME A 35 ? ? 65.38 129.50 94 10 GLU A 3 ? ? 45.29 80.98 95 10 HIS A 6 ? ? 27.09 45.36 96 10 GLU A 11 ? ? -168.78 -2.55 97 10 SER A 26 ? ? -79.99 24.74 98 10 LYS A 28 ? ? -179.79 33.72 99 10 ALA A 30 ? ? -144.11 -58.39 100 10 LEU A 34 ? ? -156.91 82.57 #