data_1BIK # _entry.id 1BIK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BIK pdb_00001bik 10.2210/pdb1bik/pdb WWPDB D_1000171799 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BIK _pdbx_database_status.recvd_initial_deposition_date 1997-11-26 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, Y.' 1 'Carr, P.D.' 2 'Guss, J.M.' 3 'Ollis, D.L.' 4 # _citation.id primary _citation.title 'The crystal structure of bikunin from the inter-alpha-inhibitor complex: a serine protease inhibitor with two Kunitz domains.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 276 _citation.page_first 955 _citation.page_last 966 _citation.year 1998 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9566199 _citation.pdbx_database_id_DOI 10.1006/jmbi.1997.1582 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, Y.' 1 ? primary 'Carr, P.D.' 2 ? primary 'Guss, J.M.' 3 ? primary 'Ollis, D.L.' 4 ? # _cell.entry_id 1BIK _cell.length_a 55.300 _cell.length_b 55.300 _cell.length_c 146.900 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BIK _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat BIKUNIN 15987.002 1 ? ? 'DOMAIN II,78 - 133' ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 water nat water 18.015 33 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MINGIN, URINARY TRYPSIN INHIBITOR, HI30, TRYPSTATIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVA ACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN ; _entity_poly.pdbx_seq_one_letter_code_can ;AVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVA ACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 VAL n 1 3 LEU n 1 4 PRO n 1 5 GLN n 1 6 GLU n 1 7 GLU n 1 8 GLU n 1 9 GLY n 1 10 SER n 1 11 GLY n 1 12 GLY n 1 13 GLY n 1 14 GLN n 1 15 LEU n 1 16 VAL n 1 17 THR n 1 18 GLU n 1 19 VAL n 1 20 THR n 1 21 LYS n 1 22 LYS n 1 23 GLU n 1 24 ASP n 1 25 SER n 1 26 CYS n 1 27 GLN n 1 28 LEU n 1 29 GLY n 1 30 TYR n 1 31 SER n 1 32 ALA n 1 33 GLY n 1 34 PRO n 1 35 CYS n 1 36 MET n 1 37 GLY n 1 38 MET n 1 39 THR n 1 40 SER n 1 41 ARG n 1 42 TYR n 1 43 PHE n 1 44 TYR n 1 45 ASN n 1 46 GLY n 1 47 THR n 1 48 SER n 1 49 MET n 1 50 ALA n 1 51 CYS n 1 52 GLU n 1 53 THR n 1 54 PHE n 1 55 GLN n 1 56 TYR n 1 57 GLY n 1 58 GLY n 1 59 CYS n 1 60 MET n 1 61 GLY n 1 62 ASN n 1 63 GLY n 1 64 ASN n 1 65 ASN n 1 66 PHE n 1 67 VAL n 1 68 THR n 1 69 GLU n 1 70 LYS n 1 71 GLU n 1 72 CYS n 1 73 LEU n 1 74 GLN n 1 75 THR n 1 76 CYS n 1 77 ARG n 1 78 THR n 1 79 VAL n 1 80 ALA n 1 81 ALA n 1 82 CYS n 1 83 ASN n 1 84 LEU n 1 85 PRO n 1 86 ILE n 1 87 VAL n 1 88 ARG n 1 89 GLY n 1 90 PRO n 1 91 CYS n 1 92 ARG n 1 93 ALA n 1 94 PHE n 1 95 ILE n 1 96 GLN n 1 97 LEU n 1 98 TRP n 1 99 ALA n 1 100 PHE n 1 101 ASP n 1 102 ALA n 1 103 VAL n 1 104 LYS n 1 105 GLY n 1 106 LYS n 1 107 CYS n 1 108 VAL n 1 109 LEU n 1 110 PHE n 1 111 PRO n 1 112 TYR n 1 113 GLY n 1 114 GLY n 1 115 CYS n 1 116 GLN n 1 117 GLY n 1 118 ASN n 1 119 GLY n 1 120 ASN n 1 121 LYS n 1 122 PHE n 1 123 TYR n 1 124 SER n 1 125 GLU n 1 126 LYS n 1 127 GLU n 1 128 CYS n 1 129 ARG n 1 130 GLU n 1 131 TYR n 1 132 CYS n 1 133 GLY n 1 134 VAL n 1 135 PRO n 1 136 GLY n 1 137 ASP n 1 138 GLY n 1 139 ASP n 1 140 GLU n 1 141 GLU n 1 142 LEU n 1 143 LEU n 1 144 ARG n 1 145 PHE n 1 146 SER n 1 147 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name human _entity_src_nat.pdbx_organism_scientific 'Homo sapiens' _entity_src_nat.pdbx_ncbi_taxonomy_id 9606 _entity_src_nat.genus Homo _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion URINE _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AMBP_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02760 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEIS MTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRET LLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPC MGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGC QGNGNKFYSEKECREYCGVPGDGDEELLRFSN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BIK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02760 _struct_ref_seq.db_align_beg 206 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 352 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 147 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1BIK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.51 _exptl_crystal.density_percent_sol 64.97 _exptl_crystal.description 'NON IDENTICAL RESIDUES TRUNCATED TO THE CB POSITION' # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7.5' # _diffrn.id 1 _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS II' _diffrn_detector.pdbx_collection_date 1995-11 _diffrn_detector.details COLLIMATOR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1BIK _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 25 _reflns.d_resolution_high 2.5 _reflns.number_obs 8519 _reflns.number_all ? _reflns.percent_possible_obs 97.7 _reflns.pdbx_Rmerge_I_obs 0.072 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.4 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.5 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.6 _reflns_shell.percent_possible_all 97.6 _reflns_shell.Rmerge_I_obs 0.21 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 10.1 _reflns_shell.pdbx_redundancy 6 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1BIK _refine.ls_number_reflns_obs 7511 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 2.5 _refine.ls_percent_reflns_obs 89.0 _refine.ls_R_factor_obs 0.205 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.205 _refine.ls_R_factor_R_free 0.253 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free 783 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'C-TERMINAL DOMAIN OF PDB ENTRY 1KNT' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 827 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.number_atoms_solvent 33 _refine_hist.number_atoms_total 884 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.635 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 25.25 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.389 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.5 _refine_ls_shell.d_res_low 2.6 _refine_ls_shell.number_reflns_R_work 696 _refine_ls_shell.R_factor_R_work 0.29 _refine_ls_shell.percent_reflns_obs 79 _refine_ls_shell.R_factor_R_free 0.305 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 10 _refine_ls_shell.number_reflns_R_free 98 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 WATER.PARM WATER.TOPO 'X-RAY DIFFRACTION' 3 SO4.PARM SO4.TOPO 'X-RAY DIFFRACTION' 4 ? GLA_NEW.TOPO 'X-RAY DIFFRACTION' # _struct.entry_id 1BIK _struct.title 'X-RAY STRUCTURE OF BIKUNIN FROM THE HUMAN INTER-ALPHA-INHIBITOR COMPLEX' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BIK _struct_keywords.pdbx_keywords GLYCOPROTEIN _struct_keywords.text ;GLYCOPROTEIN, BIKUNIN, TRYPSTATIN, URINARY TRYPSIN INHIBITOR, URONIC-ACID-RICH PROTEIN, SERINE PROTEASE INHIBITOR (KUNITZ TYPE), GLYCOSYLATED PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 69 ? CYS A 76 ? GLU A 69 CYS A 76 1 ? 8 HELX_P HELX_P2 2 VAL A 79 ? ASN A 83 ? VAL A 79 ASN A 83 5 ? 5 HELX_P HELX_P3 3 GLU A 125 ? CYS A 132 ? GLU A 125 CYS A 132 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 76 SG ? ? A CYS 26 A CYS 76 1_555 ? ? ? ? ? ? ? 2.016 ? ? disulf2 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 35 A CYS 59 1_555 ? ? ? ? ? ? ? 2.012 ? ? disulf3 disulf ? ? A CYS 51 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 51 A CYS 72 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf4 disulf ? ? A CYS 82 SG ? ? ? 1_555 A CYS 132 SG ? ? A CYS 82 A CYS 132 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf5 disulf ? ? A CYS 91 SG ? ? ? 1_555 A CYS 115 SG ? ? A CYS 91 A CYS 115 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf6 disulf ? ? A CYS 107 SG ? ? ? 1_555 A CYS 128 SG ? ? A CYS 107 A CYS 128 1_555 ? ? ? ? ? ? ? 2.027 ? ? covale1 covale one ? A ASN 45 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 45 A NAG 148 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 39 ? ASN A 45 ? THR A 39 ASN A 45 A 2 ALA A 50 ? TYR A 56 ? ALA A 50 TYR A 56 B 1 ILE A 95 ? ASP A 101 ? ILE A 95 ASP A 101 B 2 LYS A 106 ? TYR A 112 ? LYS A 106 TYR A 112 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 39 ? O THR A 39 N TYR A 56 ? N TYR A 56 B 1 2 O ILE A 95 ? O ILE A 95 N TYR A 112 ? N TYR A 112 # _database_PDB_matrix.entry_id 1BIK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BIK _atom_sites.fract_transf_matrix[1][1] 0.018083 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018083 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006807 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 GLN 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 GLU 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 GLY 11 11 ? ? ? A . n A 1 12 GLY 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 GLN 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 VAL 16 16 ? ? ? A . n A 1 17 THR 17 17 ? ? ? A . n A 1 18 GLU 18 18 ? ? ? A . n A 1 19 VAL 19 19 ? ? ? A . n A 1 20 THR 20 20 ? ? ? A . n A 1 21 LYS 21 21 ? ? ? A . n A 1 22 LYS 22 22 ? ? ? A . n A 1 23 GLU 23 23 ? ? ? A . n A 1 24 ASP 24 24 ? ? ? A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 CYS 132 132 132 CYS CYS A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 PRO 135 135 ? ? ? A . n A 1 136 GLY 136 136 ? ? ? A . n A 1 137 ASP 137 137 ? ? ? A . n A 1 138 GLY 138 138 ? ? ? A . n A 1 139 ASP 139 139 ? ? ? A . n A 1 140 GLU 140 140 ? ? ? A . n A 1 141 GLU 141 141 ? ? ? A . n A 1 142 LEU 142 142 ? ? ? A . n A 1 143 LEU 143 143 ? ? ? A . n A 1 144 ARG 144 144 ? ? ? A . n A 1 145 PHE 145 145 ? ? ? A . n A 1 146 SER 146 146 ? ? ? A . n A 1 147 ASN 147 147 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 148 45 NAG NAG A . C 3 SO4 1 149 135 SO4 SO4 A . D 3 SO4 1 150 136 SO4 SO4 A . E 4 HOH 1 151 140 HOH HOH A . E 4 HOH 2 152 141 HOH HOH A . E 4 HOH 3 153 142 HOH HOH A . E 4 HOH 4 154 143 HOH HOH A . E 4 HOH 5 155 144 HOH HOH A . E 4 HOH 6 156 145 HOH HOH A . E 4 HOH 7 157 146 HOH HOH A . E 4 HOH 8 158 147 HOH HOH A . E 4 HOH 9 159 148 HOH HOH A . E 4 HOH 10 160 149 HOH HOH A . E 4 HOH 11 161 150 HOH HOH A . E 4 HOH 12 162 151 HOH HOH A . E 4 HOH 13 163 152 HOH HOH A . E 4 HOH 14 164 153 HOH HOH A . E 4 HOH 15 165 154 HOH HOH A . E 4 HOH 16 166 155 HOH HOH A . E 4 HOH 17 167 156 HOH HOH A . E 4 HOH 18 168 157 HOH HOH A . E 4 HOH 19 169 158 HOH HOH A . E 4 HOH 20 170 159 HOH HOH A . E 4 HOH 21 171 160 HOH HOH A . E 4 HOH 22 172 161 HOH HOH A . E 4 HOH 23 173 162 HOH HOH A . E 4 HOH 24 174 163 HOH HOH A . E 4 HOH 25 175 164 HOH HOH A . E 4 HOH 26 176 165 HOH HOH A . E 4 HOH 27 177 166 HOH HOH A . E 4 HOH 28 178 167 HOH HOH A . E 4 HOH 29 179 168 HOH HOH A . E 4 HOH 30 180 169 HOH HOH A . E 4 HOH 31 181 170 HOH HOH A . E 4 HOH 32 182 171 HOH HOH A . E 4 HOH 33 183 172 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ASN _pdbx_struct_mod_residue.label_seq_id 45 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ASN _pdbx_struct_mod_residue.auth_seq_id 45 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ASN _pdbx_struct_mod_residue.details 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-03-16 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-07-29 5 'Structure model' 1 4 2023-08-02 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp 2 4 'Structure model' entity 3 4 'Structure model' pdbx_chem_comp_identifier 4 4 'Structure model' pdbx_entity_nonpoly 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site 7 4 'Structure model' struct_site_gen 8 5 'Structure model' chem_comp 9 5 'Structure model' database_2 10 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_chem_comp.name' 2 4 'Structure model' '_chem_comp.type' 3 4 'Structure model' '_entity.pdbx_description' 4 4 'Structure model' '_pdbx_entity_nonpoly.name' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_conn.pdbx_role' 7 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 8 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 12 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 18 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 19 5 'Structure model' '_chem_comp.pdbx_synonyms' 20 5 'Structure model' '_database_2.pdbx_DOI' 21 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 X-PLOR 'model building' 3.1 ? 3 X-PLOR refinement 3.1 ? 4 X-PLOR phasing 3.1 ? 5 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 27 ? CG ? A GLN 27 CG 2 1 Y 1 A GLN 27 ? CD ? A GLN 27 CD 3 1 Y 1 A GLN 27 ? OE1 ? A GLN 27 OE1 4 1 Y 1 A GLN 27 ? NE2 ? A GLN 27 NE2 5 1 Y 1 A LYS 126 ? CG ? A LYS 126 CG 6 1 Y 1 A LYS 126 ? CD ? A LYS 126 CD 7 1 Y 1 A LYS 126 ? CE ? A LYS 126 CE 8 1 Y 1 A LYS 126 ? NZ ? A LYS 126 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A GLN 5 ? A GLN 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A GLU 8 ? A GLU 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A GLY 11 ? A GLY 11 12 1 Y 1 A GLY 12 ? A GLY 12 13 1 Y 1 A GLY 13 ? A GLY 13 14 1 Y 1 A GLN 14 ? A GLN 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A VAL 16 ? A VAL 16 17 1 Y 1 A THR 17 ? A THR 17 18 1 Y 1 A GLU 18 ? A GLU 18 19 1 Y 1 A VAL 19 ? A VAL 19 20 1 Y 1 A THR 20 ? A THR 20 21 1 Y 1 A LYS 21 ? A LYS 21 22 1 Y 1 A LYS 22 ? A LYS 22 23 1 Y 1 A GLU 23 ? A GLU 23 24 1 Y 1 A ASP 24 ? A ASP 24 25 1 Y 1 A PRO 135 ? A PRO 135 26 1 Y 1 A GLY 136 ? A GLY 136 27 1 Y 1 A ASP 137 ? A ASP 137 28 1 Y 1 A GLY 138 ? A GLY 138 29 1 Y 1 A ASP 139 ? A ASP 139 30 1 Y 1 A GLU 140 ? A GLU 140 31 1 Y 1 A GLU 141 ? A GLU 141 32 1 Y 1 A LEU 142 ? A LEU 142 33 1 Y 1 A LEU 143 ? A LEU 143 34 1 Y 1 A ARG 144 ? A ARG 144 35 1 Y 1 A PHE 145 ? A PHE 145 36 1 Y 1 A SER 146 ? A SER 146 37 1 Y 1 A ASN 147 ? A ASN 147 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 'SULFATE ION' SO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1KNT _pdbx_initial_refinement_model.details 'C-TERMINAL DOMAIN OF PDB ENTRY 1KNT' #