data_1BQ9 # _entry.id 1BQ9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BQ9 pdb_00001bq9 10.2210/pdb1bq9/pdb RCSB RCSB008026 ? ? WWPDB D_1000008026 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1CAA . unspecified PDB 1BQ8 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BQ9 _pdbx_database_status.recvd_initial_deposition_date 1998-08-22 _pdbx_database_status.deposit_site BNL _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bau, R.' 1 'Rees, D.C.' 2 'Kurtz, D.M.' 3 'Scott, R.A.' 4 'Huang, H.' 5 'Adams, M.W.W.' 6 'Eidsness, M.K.' 7 # _citation.id primary _citation.title ;Crystal Structure of Rubredoxin from Pyrococcus Furiosus at 0.95 Angstroms Resolution, and the structures of N-terminal methionine and formylmethionine variants of Pf Rd. Contributions of N-terminal interactions to thermostability ; _citation.journal_abbrev J.BIOL.INORG.CHEM. _citation.journal_volume 3 _citation.page_first 484 _citation.page_last 493 _citation.year 1998 _citation.journal_id_ASTM JJBCFA _citation.country GW _citation.journal_id_ISSN 0949-8257 _citation.journal_id_CSD 2154 _citation.book_publisher ? _citation.pdbx_database_id_PubMed -1 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bau, R.' 1 ? primary 'Rees, D.C.' 2 ? primary 'Kurtz, D.M.' 3 ? primary 'Scott, R.A.' 4 ? primary 'Huang, H.' 5 ? primary 'Adams, M.W.W.' 6 ? primary 'Eidsness, M.K.' 7 ? # _cell.entry_id 1BQ9 _cell.length_a 34.029 _cell.length_b 34.474 _cell.length_c 43.470 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BQ9 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN (RUBREDOXIN)' 6059.738 1 ? 'FMET INSERTED IN N-TERMINAL POSITION' ? ? 2 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 3 water nat water 18.015 159 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PF RD' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(FME)AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED' _entity_poly.pdbx_seq_one_letter_code_can MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 FME n 1 2 ALA n 1 3 LYS n 1 4 TRP n 1 5 VAL n 1 6 CYS n 1 7 LYS n 1 8 ILE n 1 9 CYS n 1 10 GLY n 1 11 TYR n 1 12 ILE n 1 13 TYR n 1 14 ASP n 1 15 GLU n 1 16 ASP n 1 17 ALA n 1 18 GLY n 1 19 ASP n 1 20 PRO n 1 21 ASP n 1 22 ASN n 1 23 GLY n 1 24 ILE n 1 25 SER n 1 26 PRO n 1 27 GLY n 1 28 THR n 1 29 LYS n 1 30 PHE n 1 31 GLU n 1 32 GLU n 1 33 LEU n 1 34 PRO n 1 35 ASP n 1 36 ASP n 1 37 TRP n 1 38 VAL n 1 39 CYS n 1 40 PRO n 1 41 ILE n 1 42 CYS n 1 43 GLY n 1 44 ALA n 1 45 PRO n 1 46 LYS n 1 47 SER n 1 48 GLU n 1 49 PHE n 1 50 GLU n 1 51 LYS n 1 52 LEU n 1 53 GLU n 1 54 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant FMET _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'PRODUCT OF A SYNTHETIC PF RD GENE' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RUBR_PYRFU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P24297 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BQ9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P24297 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 54 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 54 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1BQ9 _struct_ref_seq_dif.mon_id FME _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P24297 _struct_ref_seq_dif.db_mon_id MET _struct_ref_seq_dif.pdbx_seq_db_seq_num 1 _struct_ref_seq_dif.details 'modified residue' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 FME 'L-peptide linking' n N-FORMYLMETHIONINE ? 'C6 H11 N O3 S' 177.221 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1BQ9 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_percent_sol 41.49 _exptl_crystal.description 'KNOWN STRUCTURE (SEE TEXT)' # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_details 'VAPOR DIFFUSION AGAINST 3.6M NA,K PHOSPHATE, pH 8.5, vapor diffusion' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 123 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type 'SIEMENS X-1000' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source ? _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1BQ9 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 1.2 _reflns.number_obs 15400 _reflns.number_all ? _reflns.percent_possible_obs 97.5 _reflns.pdbx_Rmerge_I_obs 0.0600000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 5.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.2 _reflns_shell.d_res_low 1.4 _reflns_shell.percent_possible_all 83.8 _reflns_shell.Rmerge_I_obs 0.1660000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 3.0 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1BQ9 _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all 14030 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.0 _refine.ls_d_res_high 1.2 _refine.ls_percent_reflns_obs 97.5 _refine.ls_R_factor_obs 0.1370000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free 0.1660000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters 4664 _refine.ls_number_restraints 5076 _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details 'ANISOTROPIC C,N,O,S,FE ATOMS B23 (A**2) : ESTIMATED OVERALL COORDINATE ERROR.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'EVERY 10TH REFLECTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1BQ9 _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues 7 _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 439 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 159 _refine_hist.number_atoms_total 599 _refine_hist.d_res_high 1.2 _refine_hist.d_res_low 50.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.022 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.022 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist ? ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes ? ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol ? ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol ? ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 2.6 ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt ? ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt ? ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps ? ? ? ? 'X-RAY DIFFRACTION' ? # _pdbx_refine.entry_id 1BQ9 _pdbx_refine.R_factor_all_no_cutoff ? _pdbx_refine.R_factor_obs_no_cutoff 0.1370000 _pdbx_refine.free_R_factor_no_cutoff 0.1660000 _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff 0.1330000 _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff 12478 _pdbx_refine.number_reflns_obs_no_cutoff ? _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.free_R_error_no_cutoff ? # _struct.entry_id 1BQ9 _struct.title 'Rubredoxin (Formyl Methionine Mutant) from Pyrococcus Furiosus' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BQ9 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'IRON-SULFUR PROTEIN, HIGH-RESOLUTION STRUCTURE, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 20 ? ASN A 22 ? PRO A 20 ASN A 22 5 ? 3 HELX_P HELX_P2 2 PHE A 30 ? GLU A 32 ? PHE A 30 GLU A 32 5 ? 3 HELX_P HELX_P3 3 LYS A 46 ? GLU A 48 ? LYS A 46 GLU A 48 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A FME 1 C ? ? ? 1_555 A ALA 2 N ? ? A FME 1 A ALA 2 1_555 ? ? ? ? ? ? ? 1.297 ? ? metalc1 metalc ? ? A CYS 6 SG ? ? ? 1_555 B FE . FE ? ? A CYS 6 A FE 55 1_555 ? ? ? ? ? ? ? 2.274 ? ? metalc2 metalc ? ? A CYS 9 SG ? ? ? 1_555 B FE . FE ? ? A CYS 9 A FE 55 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc3 metalc ? ? A CYS 39 SG ? ? ? 1_555 B FE . FE ? ? A CYS 39 A FE 55 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc4 metalc ? ? A CYS 42 SG ? ? ? 1_555 B FE . FE ? ? A CYS 42 A FE 55 1_555 ? ? ? ? ? ? ? 2.256 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 12 ? ASP A 14 ? ILE A 12 ASP A 14 A 2 LYS A 3 ? CYS A 6 ? LYS A 3 CYS A 6 A 3 PHE A 49 ? LYS A 51 ? PHE A 49 LYS A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 13 ? O TYR A 13 N TRP A 4 ? N TRP A 4 A 2 3 O VAL A 5 ? O VAL A 5 N GLU A 50 ? N GLU A 50 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id FE _struct_site.pdbx_auth_seq_id 55 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE FE A 55' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 6 ? CYS A 6 . ? 1_555 ? 2 AC1 4 CYS A 9 ? CYS A 9 . ? 1_555 ? 3 AC1 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 4 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? # _database_PDB_matrix.entry_id 1BQ9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BQ9 _atom_sites.fract_transf_matrix[1][1] 0.029387 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.029007 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023004 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 FME 1 1 1 FME FME A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASP 54 54 54 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 55 55 FE FE A . C 3 HOH 1 101 101 HOH HOH A . C 3 HOH 2 102 102 HOH HOH A . C 3 HOH 3 103 103 HOH HOH A . C 3 HOH 4 104 104 HOH HOH A . C 3 HOH 5 105 105 HOH HOH A . C 3 HOH 6 106 106 HOH HOH A . C 3 HOH 7 107 107 HOH HOH A . C 3 HOH 8 108 108 HOH HOH A . C 3 HOH 9 109 109 HOH HOH A . C 3 HOH 10 110 110 HOH HOH A . C 3 HOH 11 111 111 HOH HOH A . C 3 HOH 12 112 112 HOH HOH A . C 3 HOH 13 113 113 HOH HOH A . C 3 HOH 14 114 114 HOH HOH A . C 3 HOH 15 115 115 HOH HOH A . C 3 HOH 16 116 116 HOH HOH A . C 3 HOH 17 117 117 HOH HOH A . C 3 HOH 18 118 118 HOH HOH A . C 3 HOH 19 119 119 HOH HOH A . C 3 HOH 20 120 120 HOH HOH A . C 3 HOH 21 121 121 HOH HOH A . C 3 HOH 22 122 122 HOH HOH A . C 3 HOH 23 123 123 HOH HOH A . C 3 HOH 24 124 124 HOH HOH A . C 3 HOH 25 125 125 HOH HOH A . C 3 HOH 26 126 126 HOH HOH A . C 3 HOH 27 127 127 HOH HOH A . C 3 HOH 28 128 128 HOH HOH A . C 3 HOH 29 129 129 HOH HOH A . C 3 HOH 30 130 130 HOH HOH A . C 3 HOH 31 131 131 HOH HOH A . C 3 HOH 32 132 132 HOH HOH A . C 3 HOH 33 133 133 HOH HOH A . C 3 HOH 34 134 134 HOH HOH A . C 3 HOH 35 135 135 HOH HOH A . C 3 HOH 36 136 136 HOH HOH A . C 3 HOH 37 137 137 HOH HOH A . C 3 HOH 38 138 138 HOH HOH A . C 3 HOH 39 139 139 HOH HOH A . C 3 HOH 40 140 140 HOH HOH A . C 3 HOH 41 141 141 HOH HOH A . C 3 HOH 42 142 142 HOH HOH A . C 3 HOH 43 143 143 HOH HOH A . C 3 HOH 44 144 144 HOH HOH A . C 3 HOH 45 145 145 HOH HOH A . C 3 HOH 46 146 146 HOH HOH A . C 3 HOH 47 147 147 HOH HOH A . C 3 HOH 48 148 148 HOH HOH A . C 3 HOH 49 149 149 HOH HOH A . C 3 HOH 50 150 150 HOH HOH A . C 3 HOH 51 151 151 HOH HOH A . C 3 HOH 52 152 152 HOH HOH A . C 3 HOH 53 153 153 HOH HOH A . C 3 HOH 54 154 154 HOH HOH A . C 3 HOH 55 155 155 HOH HOH A . C 3 HOH 56 156 156 HOH HOH A . C 3 HOH 57 157 157 HOH HOH A . C 3 HOH 58 158 158 HOH HOH A . C 3 HOH 59 159 159 HOH HOH A . C 3 HOH 60 160 160 HOH HOH A . C 3 HOH 61 161 161 HOH HOH A . C 3 HOH 62 162 162 HOH HOH A . C 3 HOH 63 163 163 HOH HOH A . C 3 HOH 64 164 164 HOH HOH A . C 3 HOH 65 165 165 HOH HOH A . C 3 HOH 66 166 166 HOH HOH A . C 3 HOH 67 167 167 HOH HOH A . C 3 HOH 68 168 168 HOH HOH A . C 3 HOH 69 169 169 HOH HOH A . C 3 HOH 70 170 170 HOH HOH A . C 3 HOH 71 171 171 HOH HOH A . C 3 HOH 72 172 172 HOH HOH A . C 3 HOH 73 173 173 HOH HOH A . C 3 HOH 74 174 174 HOH HOH A . C 3 HOH 75 175 175 HOH HOH A . C 3 HOH 76 176 176 HOH HOH A . C 3 HOH 77 177 177 HOH HOH A . C 3 HOH 78 178 178 HOH HOH A . C 3 HOH 79 179 179 HOH HOH A . C 3 HOH 80 180 180 HOH HOH A . C 3 HOH 81 181 181 HOH HOH A . C 3 HOH 82 201 201 HOH HOH A . C 3 HOH 83 202 202 HOH HOH A . C 3 HOH 84 203 203 HOH HOH A . C 3 HOH 85 204 204 HOH HOH A . C 3 HOH 86 205 205 HOH HOH A . C 3 HOH 87 206 206 HOH HOH A . C 3 HOH 88 207 207 HOH HOH A . C 3 HOH 89 208 208 HOH HOH A . C 3 HOH 90 209 209 HOH HOH A . C 3 HOH 91 210 210 HOH HOH A . C 3 HOH 92 211 211 HOH HOH A . C 3 HOH 93 212 212 HOH HOH A . C 3 HOH 94 213 213 HOH HOH A . C 3 HOH 95 214 214 HOH HOH A . C 3 HOH 96 215 215 HOH HOH A . C 3 HOH 97 216 216 HOH HOH A . C 3 HOH 98 217 217 HOH HOH A . C 3 HOH 99 218 218 HOH HOH A . C 3 HOH 100 219 219 HOH HOH A . C 3 HOH 101 220 220 HOH HOH A . C 3 HOH 102 221 221 HOH HOH A . C 3 HOH 103 222 222 HOH HOH A . C 3 HOH 104 223 223 HOH HOH A . C 3 HOH 105 224 224 HOH HOH A . C 3 HOH 106 225 225 HOH HOH A . C 3 HOH 107 226 226 HOH HOH A . C 3 HOH 108 227 227 HOH HOH A . C 3 HOH 109 228 228 HOH HOH A . C 3 HOH 110 229 229 HOH HOH A . C 3 HOH 111 230 230 HOH HOH A . C 3 HOH 112 231 231 HOH HOH A . C 3 HOH 113 232 232 HOH HOH A . C 3 HOH 114 233 233 HOH HOH A . C 3 HOH 115 234 234 HOH HOH A . C 3 HOH 116 235 235 HOH HOH A . C 3 HOH 117 236 236 HOH HOH A . C 3 HOH 118 237 237 HOH HOH A . C 3 HOH 119 238 238 HOH HOH A . C 3 HOH 120 239 239 HOH HOH A . C 3 HOH 121 301 301 HOH HOH A . C 3 HOH 122 302 302 HOH HOH A . C 3 HOH 123 303 303 HOH HOH A . C 3 HOH 124 304 304 HOH HOH A . C 3 HOH 125 305 305 HOH HOH A . C 3 HOH 126 306 306 HOH HOH A . C 3 HOH 127 307 307 HOH HOH A . C 3 HOH 128 308 308 HOH HOH A . C 3 HOH 129 309 309 HOH HOH A . C 3 HOH 130 310 310 HOH HOH A . C 3 HOH 131 311 311 HOH HOH A . C 3 HOH 132 312 312 HOH HOH A . C 3 HOH 133 313 313 HOH HOH A . C 3 HOH 134 314 314 HOH HOH A . C 3 HOH 135 315 315 HOH HOH A . C 3 HOH 136 316 316 HOH HOH A . C 3 HOH 137 317 317 HOH HOH A . C 3 HOH 138 318 318 HOH HOH A . C 3 HOH 139 319 319 HOH HOH A . C 3 HOH 140 320 320 HOH HOH A . C 3 HOH 141 321 321 HOH HOH A . C 3 HOH 142 322 322 HOH HOH A . C 3 HOH 143 323 323 HOH HOH A . C 3 HOH 144 324 324 HOH HOH A . C 3 HOH 145 325 325 HOH HOH A . C 3 HOH 146 326 326 HOH HOH A . C 3 HOH 147 327 327 HOH HOH A . C 3 HOH 148 328 328 HOH HOH A . C 3 HOH 149 329 329 HOH HOH A . C 3 HOH 150 330 330 HOH HOH A . C 3 HOH 151 331 331 HOH HOH A . C 3 HOH 152 332 332 HOH HOH A . C 3 HOH 153 333 333 HOH HOH A . C 3 HOH 154 334 334 HOH HOH A . C 3 HOH 155 335 335 HOH HOH A . C 3 HOH 156 336 336 HOH HOH A . C 3 HOH 157 337 337 HOH HOH A . C 3 HOH 158 338 338 HOH HOH A . C 3 HOH 159 339 339 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id FME _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id FME _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details N-FORMYLMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 6 ? A CYS 6 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 9 ? A CYS 9 ? 1_555 113.0 ? 2 SG ? A CYS 6 ? A CYS 6 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 111.6 ? 3 SG ? A CYS 9 ? A CYS 9 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 102.6 ? 4 SG ? A CYS 6 ? A CYS 6 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 104.0 ? 5 SG ? A CYS 9 ? A CYS 9 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 113.4 ? 6 SG ? A CYS 39 ? A CYS 39 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 112.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-08-26 2 'Structure model' 1 1 2007-10-21 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-04 5 'Structure model' 1 4 2022-12-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Database references' 5 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' database_2 3 5 'Structure model' struct_conn 4 5 'Structure model' struct_conn_type 5 5 'Structure model' struct_ref_seq_dif 6 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.name' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_struct_conn.conn_type_id' 5 5 'Structure model' '_struct_conn.id' 6 5 'Structure model' '_struct_conn.pdbx_dist_value' 7 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 8 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 9 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 10 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 11 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 12 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 13 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 14 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 15 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 16 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 17 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 18 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 19 5 'Structure model' '_struct_conn_type.id' 20 5 'Structure model' '_struct_ref_seq_dif.details' 21 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 22 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 23 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHELXL refinement . ? 1 XDS 'data reduction' . ? 2 XSCALE 'data scaling' . ? 3 # _pdbx_entry_details.entry_id 1BQ9 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;FME IS IN HET DICTIONARY FE OF FES4 UNIT ; _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 16 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OD2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ASP _pdbx_validate_symm_contact.auth_seq_id_2 54 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_655 _pdbx_validate_symm_contact.dist 1.83 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A GLU 32 ? ? CD A GLU 32 ? B 2.015 1.515 0.500 0.015 N 2 1 CD A GLU 32 ? B OE1 A GLU 32 ? B 1.855 1.252 0.603 0.011 N 3 1 CD A GLU 32 ? B OE2 A GLU 32 ? B 2.109 1.252 0.857 0.011 N 4 1 CB A ASP 36 ? ? CG A ASP 36 ? B 1.733 1.513 0.220 0.021 N 5 1 CG A ASP 36 ? B OD1 A ASP 36 ? B 2.076 1.249 0.827 0.023 N 6 1 CB A GLU 50 ? ? CG A GLU 50 ? B 1.148 1.517 -0.369 0.019 N 7 1 CG A GLU 50 ? B CD A GLU 50 ? B 2.725 1.515 1.210 0.015 N 8 1 CD A GLU 50 ? B OE1 A GLU 50 ? B 2.126 1.252 0.874 0.011 N 9 1 CD A GLU 50 ? B OE2 A GLU 50 ? B 1.151 1.252 -0.101 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ILE 8 ? ? CG1 A ILE 8 ? ? CD1 A ILE 8 ? B 92.70 113.90 -21.20 2.80 N 2 1 OE1 A GLU 32 ? B CD A GLU 32 ? B OE2 A GLU 32 ? B 92.69 123.30 -30.61 1.20 N 3 1 CG A GLU 32 ? ? CD A GLU 32 ? B OE1 A GLU 32 ? B 148.08 118.30 29.78 2.00 N 4 1 OD1 A ASP 36 ? B CG A ASP 36 ? B OD2 A ASP 36 ? B 99.81 123.30 -23.49 1.90 N 5 1 CB A ASP 36 ? ? CG A ASP 36 ? B OD1 A ASP 36 ? B 163.24 118.30 44.94 0.90 N 6 1 CB A ASP 36 ? ? CG A ASP 36 ? B OD2 A ASP 36 ? B 90.00 118.30 -28.30 0.90 N 7 1 CB A ILE 41 ? ? CG1 A ILE 41 ? ? CD1 A ILE 41 ? B 94.90 113.90 -19.00 2.80 N 8 1 CA A GLU 50 ? ? CB A GLU 50 ? ? CG A GLU 50 ? B 97.92 113.40 -15.48 2.20 N 9 1 OE1 A GLU 50 ? B CD A GLU 50 ? B OE2 A GLU 50 ? B 115.59 123.30 -7.71 1.20 N 10 1 CG A GLU 50 ? B CD A GLU 50 ? B OE1 A GLU 50 ? B 67.38 118.30 -50.92 2.00 N 11 1 CG A GLU 50 ? B CD A GLU 50 ? B OE2 A GLU 50 ? B 81.49 118.30 -36.81 2.00 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 19 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -157.31 _pdbx_validate_torsion.psi 68.22 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id GLY _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 27 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -12.90 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 GLU A 32 ? ? 0.107 'SIDE CHAIN' 2 1 ASP A 36 ? ? 0.082 'SIDE CHAIN' 3 1 GLU A 50 ? ? 0.295 'SIDE CHAIN' # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 water HOH #