data_1BRA # _entry.id 1BRA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1BRA WWPDB D_1000172022 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BRA _pdbx_database_status.recvd_initial_deposition_date 1992-12-17 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Perona, J.J.' 1 'Mcgrath, M.E.' 2 'Fletterick, R.J.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Relocating a negative charge in the binding pocket of trypsin.' J.Mol.Biol. 230 934 949 1993 JMOBAK UK 0022-2836 0070 ? 8478942 10.1006/jmbi.1993.1211 1 'Crystal Structures of Rat Anionic Trypsin Complexed with the Protein Inhibitors Appi and Bpti' J.Mol.Biol. 230 919 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Perona, J.J.' 1 primary 'Tsu, C.A.' 2 primary 'McGrath, M.E.' 3 primary 'Craik, C.S.' 4 primary 'Fletterick, R.J.' 5 1 'Perona, J.J.' 6 1 'Tsu, C.A.' 7 1 'Craik, C.S.' 8 1 'Fletterick, R.J.' 9 # _cell.entry_id 1BRA _cell.length_a 124.400 _cell.length_b 124.400 _cell.length_c 124.400 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BRA _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man TRYPSIN 23814.838 1 3.4.21.4 ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn BENZAMIDINE 120.152 1 ? ? ? ? 4 water nat water 18.015 137 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKT LNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNM VCVGFLEGGKGSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPDVYTKVCNYVDWIQDTIAAN ; _entity_poly.pdbx_seq_one_letter_code_can ;IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKT LNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNM VCVGFLEGGKGSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPDVYTKVCNYVDWIQDTIAAN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 TYR n 1 6 THR n 1 7 CYS n 1 8 GLN n 1 9 GLU n 1 10 ASN n 1 11 SER n 1 12 VAL n 1 13 PRO n 1 14 TYR n 1 15 GLN n 1 16 VAL n 1 17 SER n 1 18 LEU n 1 19 ASN n 1 20 SER n 1 21 GLY n 1 22 TYR n 1 23 HIS n 1 24 PHE n 1 25 CYS n 1 26 GLY n 1 27 GLY n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 ASN n 1 32 ASP n 1 33 GLN n 1 34 TRP n 1 35 VAL n 1 36 VAL n 1 37 SER n 1 38 ALA n 1 39 ALA n 1 40 HIS n 1 41 CYS n 1 42 TYR n 1 43 LYS n 1 44 SER n 1 45 ARG n 1 46 ILE n 1 47 GLN n 1 48 VAL n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 GLU n 1 53 HIS n 1 54 ASN n 1 55 ILE n 1 56 ASN n 1 57 VAL n 1 58 LEU n 1 59 GLU n 1 60 GLY n 1 61 ASN n 1 62 GLU n 1 63 GLN n 1 64 PHE n 1 65 VAL n 1 66 ASN n 1 67 ALA n 1 68 ALA n 1 69 LYS n 1 70 ILE n 1 71 ILE n 1 72 LYS n 1 73 HIS n 1 74 PRO n 1 75 ASN n 1 76 PHE n 1 77 ASP n 1 78 ARG n 1 79 LYS n 1 80 THR n 1 81 LEU n 1 82 ASN n 1 83 ASN n 1 84 ASP n 1 85 ILE n 1 86 MET n 1 87 LEU n 1 88 ILE n 1 89 LYS n 1 90 LEU n 1 91 SER n 1 92 SER n 1 93 PRO n 1 94 VAL n 1 95 LYS n 1 96 LEU n 1 97 ASN n 1 98 ALA n 1 99 ARG n 1 100 VAL n 1 101 ALA n 1 102 THR n 1 103 VAL n 1 104 ALA n 1 105 LEU n 1 106 PRO n 1 107 SER n 1 108 SER n 1 109 CYS n 1 110 ALA n 1 111 PRO n 1 112 ALA n 1 113 GLY n 1 114 THR n 1 115 GLN n 1 116 CYS n 1 117 LEU n 1 118 ILE n 1 119 SER n 1 120 GLY n 1 121 TRP n 1 122 GLY n 1 123 ASN n 1 124 THR n 1 125 LEU n 1 126 SER n 1 127 SER n 1 128 GLY n 1 129 VAL n 1 130 ASN n 1 131 GLU n 1 132 PRO n 1 133 ASP n 1 134 LEU n 1 135 LEU n 1 136 GLN n 1 137 CYS n 1 138 LEU n 1 139 ASP n 1 140 ALA n 1 141 PRO n 1 142 LEU n 1 143 LEU n 1 144 PRO n 1 145 GLN n 1 146 ALA n 1 147 ASP n 1 148 CYS n 1 149 GLU n 1 150 ALA n 1 151 SER n 1 152 TYR n 1 153 PRO n 1 154 GLY n 1 155 LYS n 1 156 ILE n 1 157 THR n 1 158 ASP n 1 159 ASN n 1 160 MET n 1 161 VAL n 1 162 CYS n 1 163 VAL n 1 164 GLY n 1 165 PHE n 1 166 LEU n 1 167 GLU n 1 168 GLY n 1 169 GLY n 1 170 LYS n 1 171 GLY n 1 172 SER n 1 173 CYS n 1 174 GLN n 1 175 GLY n 1 176 ASP n 1 177 SER n 1 178 GLY n 1 179 GLY n 1 180 PRO n 1 181 VAL n 1 182 VAL n 1 183 CYS n 1 184 ASN n 1 185 GLY n 1 186 GLU n 1 187 LEU n 1 188 GLN n 1 189 GLY n 1 190 ILE n 1 191 VAL n 1 192 SER n 1 193 TRP n 1 194 GLY n 1 195 TYR n 1 196 GLY n 1 197 CYS n 1 198 ALA n 1 199 LEU n 1 200 PRO n 1 201 ASP n 1 202 ASN n 1 203 PRO n 1 204 ASP n 1 205 VAL n 1 206 TYR n 1 207 THR n 1 208 LYS n 1 209 VAL n 1 210 CYS n 1 211 ASN n 1 212 TYR n 1 213 VAL n 1 214 ASP n 1 215 TRP n 1 216 ILE n 1 217 GLN n 1 218 ASP n 1 219 THR n 1 220 ILE n 1 221 ALA n 1 222 ALA n 1 223 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'black rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus rattus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10117 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRY2_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00763 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MRALLFLALVGAAVAFPVDDDDKIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINV LEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQC LDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQ DTIAAN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BRA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 223 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00763 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 246 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 245 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1BRA GLY A 171 ? UNP P00763 ASP 194 CONFLICT 189 1 1 1BRA ASP A 204 ? UNP P00763 GLY 227 CONFLICT 226 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BEN non-polymer . BENZAMIDINE ? 'C7 H8 N2' 120.152 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1BRA _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.37 _exptl_crystal.density_percent_sol 63.46 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1BRA _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.0 _refine.ls_d_res_high 2.2 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.156 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1666 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 137 _refine_hist.number_atoms_total 1813 _refine_hist.d_res_high 2.2 _refine_hist.d_res_low 6.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.012 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_d 3.2 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d ? ? ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_plane_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1BRA _struct.title 'RELOCATING A NEGATIVE CHARGE IN THE BINDING POCKET OF TRYPSIN' _struct.pdbx_descriptor 'TRYPSIN (E.C.3.4.21.4) VARIANT (D189G,G226D) COMPLEXED WITH BENZAMIDINE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BRA _struct_keywords.pdbx_keywords PROTEINASE/INHIBITOR _struct_keywords.text 'PROTEINASE/INHIBITOR, PROTEINASE-INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 SHA PRO A 144 ? TYR A 152 ? PRO A 164 TYR A 172 1 'IRREGULAR AFTER CYS 168' 9 HELX_P HELX_P2 31A LYS A 208 ? VAL A 213 ? LYS A 230 VAL A 235 5 'LEADS INTO TERMINAL ALPHA-HLX' 6 HELX_P HELX_P3 TEA TYR A 212 ? ASN A 223 ? TYR A 234 ASN A 245 1 'C-TERMINAL HELIX' 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 22 A CYS 157 1_555 ? ? ? ? ? ? ? 2.034 ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.028 ? disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.051 ? disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.039 ? disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.012 ? disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.050 ? metalc1 metalc ? ? B CA . CA ? ? ? 1_555 A GLU 52 OE1 ? ? A CA 302 A GLU 70 1_555 ? ? ? ? ? ? ? 2.114 ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 A VAL 57 O ? ? A CA 302 A VAL 75 1_555 ? ? ? ? ? ? ? 1.961 ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 A GLU 59 OE1 ? ? A CA 302 A GLU 77 1_555 ? ? ? ? ? ? ? 2.251 ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 A GLU 62 OE2 ? ? A CA 302 A GLU 80 1_555 ? ? ? ? ? ? ? 1.976 ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 302 A HOH 261 1_555 ? ? ? ? ? ? ? 2.183 ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 A ASN 54 O ? ? A CA 302 A ASN 72 1_555 ? ? ? ? ? ? ? 2.352 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1A ? 7 ? S2A ? 4 ? S3A ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1A 1 2 ? anti-parallel S1A 2 3 ? anti-parallel S1A 3 4 ? anti-parallel S1A 4 5 ? anti-parallel S1A 5 6 ? anti-parallel S1A 6 7 ? anti-parallel S2A 1 2 ? anti-parallel S2A 2 3 ? anti-parallel S2A 3 4 ? anti-parallel S3A 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1A 1 TYR A 5 ? TYR A 5 ? TYR A 20 TYR A 20 S1A 2 GLN A 136 ? PRO A 141 ? GLN A 156 PRO A 161 S1A 3 CYS A 116 ? GLY A 120 ? CYS A 136 GLY A 140 S1A 4 GLY A 179 ? CYS A 183 ? GLY A 197 CYS A 201 S1A 5 GLU A 186 ? TRP A 193 ? GLU A 204 TRP A 215 S1A 6 ASP A 204 ? VAL A 209 ? ASP A 226 VAL A 231 S1A 7 ASN A 159 ? VAL A 163 ? ASN A 179 VAL A 183 S2A 1 GLY A 26 ? SER A 28 ? GLY A 43 SER A 45 S2A 2 VAL A 35 ? ALA A 38 ? VAL A 52 ALA A 55 S2A 3 ILE A 85 ? LYS A 89 ? ILE A 103 LYS A 107 S2A 4 LYS A 69 ? HIS A 73 ? LYS A 87 HIS A 91 S3A 1 ILE A 46 ? VAL A 48 ? ILE A 63 VAL A 66 S3A 2 GLN A 63 ? ALA A 67 ? GLN A 81 ALA A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1A 1 2 N TYR A 5 ? N TYR A 20 O CYS A 137 ? O CYS A 157 S1A 2 3 N ALA A 140 ? N ALA A 160 O CYS A 116 ? O CYS A 136 S1A 3 4 O LEU A 117 ? O LEU A 137 N VAL A 182 ? N VAL A 200 S1A 4 5 O GLY A 179 ? O GLY A 197 N VAL A 191 ? N VAL A 213 S1A 5 6 O TRP A 193 ? O TRP A 215 N VAL A 205 ? N VAL A 227 S1A 6 7 O ASP A 204 ? O ASP A 226 N VAL A 163 ? N VAL A 183 S2A 1 2 O SER A 28 ? O SER A 45 N VAL A 36 ? N VAL A 53 S2A 2 3 N SER A 37 ? N SER A 54 O MET A 86 ? O MET A 104 S2A 3 4 O ILE A 85 ? O ILE A 103 N HIS A 73 ? N HIS A 91 S3A 1 2 O VAL A 48 ? O VAL A 66 N GLN A 63 ? N GLN A 81 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CAT Author ? ? ? ? 3 'CATALYTIC TRIAD RESIDUES, CONSERVED IN ALL SERINE PROTEASES OF THE TRYPSIN AND SUBTILISIN STRUCTURAL CLASSES' AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 302' AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BEN A 246' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAT 3 HIS A 40 ? HIS A 57 . ? 1_555 ? 2 CAT 3 ASP A 84 ? ASP A 102 . ? 1_555 ? 3 CAT 3 SER A 177 ? SER A 195 . ? 1_555 ? 4 AC1 6 GLU A 52 ? GLU A 70 . ? 1_555 ? 5 AC1 6 ASN A 54 ? ASN A 72 . ? 1_555 ? 6 AC1 6 VAL A 57 ? VAL A 75 . ? 1_555 ? 7 AC1 6 GLU A 59 ? GLU A 77 . ? 1_555 ? 8 AC1 6 GLU A 62 ? GLU A 80 . ? 1_555 ? 9 AC1 6 HOH D . ? HOH A 261 . ? 1_555 ? 10 AC2 10 SER A 172 ? SER A 190 . ? 1_555 ? 11 AC2 10 GLN A 174 ? GLN A 192 . ? 1_555 ? 12 AC2 10 SER A 177 ? SER A 195 . ? 1_555 ? 13 AC2 10 VAL A 191 ? VAL A 213 . ? 1_555 ? 14 AC2 10 SER A 192 ? SER A 214 . ? 1_555 ? 15 AC2 10 GLY A 194 ? GLY A 216 . ? 1_555 ? 16 AC2 10 GLY A 196 ? GLY A 219 . ? 1_555 ? 17 AC2 10 ASP A 204 ? ASP A 226 . ? 1_555 ? 18 AC2 10 HOH D . ? HOH A 359 . ? 1_555 ? 19 AC2 10 HOH D . ? HOH A 391 . ? 1_555 ? # _database_PDB_matrix.entry_id 1BRA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BRA _atom_sites.fract_transf_matrix[1][1] 0.008039 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008039 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008039 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 TYR 5 20 20 TYR TYR A . n A 1 6 THR 6 21 21 THR THR A . n A 1 7 CYS 7 22 22 CYS CYS A . n A 1 8 GLN 8 23 23 GLN GLN A . n A 1 9 GLU 9 24 24 GLU GLU A . n A 1 10 ASN 10 25 25 ASN ASN A . n A 1 11 SER 11 26 26 SER SER A . n A 1 12 VAL 12 27 27 VAL VAL A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TYR 14 29 29 TYR TYR A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 VAL 16 31 31 VAL VAL A . n A 1 17 SER 17 32 32 SER SER A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 ASN 19 34 34 ASN ASN A . n A 1 20 SER 20 37 37 SER SER A . n A 1 21 GLY 21 38 38 GLY GLY A . n A 1 22 TYR 22 39 39 TYR TYR A . n A 1 23 HIS 23 40 40 HIS HIS A . n A 1 24 PHE 24 41 41 PHE PHE A . n A 1 25 CYS 25 42 42 CYS CYS A . n A 1 26 GLY 26 43 43 GLY GLY A . n A 1 27 GLY 27 44 44 GLY GLY A . n A 1 28 SER 28 45 45 SER SER A . n A 1 29 LEU 29 46 46 LEU LEU A . n A 1 30 ILE 30 47 47 ILE ILE A . n A 1 31 ASN 31 48 48 ASN ASN A . n A 1 32 ASP 32 49 49 ASP ASP A . n A 1 33 GLN 33 50 50 GLN GLN A . n A 1 34 TRP 34 51 51 TRP TRP A . n A 1 35 VAL 35 52 52 VAL VAL A . n A 1 36 VAL 36 53 53 VAL VAL A . n A 1 37 SER 37 54 54 SER SER A . n A 1 38 ALA 38 55 55 ALA ALA A . n A 1 39 ALA 39 56 56 ALA ALA A . n A 1 40 HIS 40 57 57 HIS HIS A . n A 1 41 CYS 41 58 58 CYS CYS A . n A 1 42 TYR 42 59 59 TYR TYR A . n A 1 43 LYS 43 60 60 LYS LYS A . n A 1 44 SER 44 61 61 SER SER A . n A 1 45 ARG 45 62 62 ARG ARG A . n A 1 46 ILE 46 63 63 ILE ILE A . n A 1 47 GLN 47 64 64 GLN GLN A . n A 1 48 VAL 48 66 66 VAL VAL A . n A 1 49 ARG 49 67 67 ARG ARG A . n A 1 50 LEU 50 68 68 LEU LEU A . n A 1 51 GLY 51 69 69 GLY GLY A . n A 1 52 GLU 52 70 70 GLU GLU A . n A 1 53 HIS 53 71 71 HIS HIS A . n A 1 54 ASN 54 72 72 ASN ASN A . n A 1 55 ILE 55 73 73 ILE ILE A . n A 1 56 ASN 56 74 74 ASN ASN A . n A 1 57 VAL 57 75 75 VAL VAL A . n A 1 58 LEU 58 76 76 LEU LEU A . n A 1 59 GLU 59 77 77 GLU GLU A . n A 1 60 GLY 60 78 78 GLY GLY A . n A 1 61 ASN 61 79 79 ASN ASN A . n A 1 62 GLU 62 80 80 GLU GLU A . n A 1 63 GLN 63 81 81 GLN GLN A . n A 1 64 PHE 64 82 82 PHE PHE A . n A 1 65 VAL 65 83 83 VAL VAL A . n A 1 66 ASN 66 84 84 ASN ASN A . n A 1 67 ALA 67 85 85 ALA ALA A . n A 1 68 ALA 68 86 86 ALA ALA A . n A 1 69 LYS 69 87 87 LYS LYS A . n A 1 70 ILE 70 88 88 ILE ILE A . n A 1 71 ILE 71 89 89 ILE ILE A . n A 1 72 LYS 72 90 90 LYS LYS A . n A 1 73 HIS 73 91 91 HIS HIS A . n A 1 74 PRO 74 92 92 PRO PRO A . n A 1 75 ASN 75 93 93 ASN ASN A . n A 1 76 PHE 76 94 94 PHE PHE A . n A 1 77 ASP 77 95 95 ASP ASP A . n A 1 78 ARG 78 96 96 ARG ARG A . n A 1 79 LYS 79 97 97 LYS LYS A . n A 1 80 THR 80 98 98 THR THR A . n A 1 81 LEU 81 99 99 LEU LEU A . n A 1 82 ASN 82 100 100 ASN ASN A . n A 1 83 ASN 83 101 101 ASN ASN A . n A 1 84 ASP 84 102 102 ASP ASP A . n A 1 85 ILE 85 103 103 ILE ILE A . n A 1 86 MET 86 104 104 MET MET A . n A 1 87 LEU 87 105 105 LEU LEU A . n A 1 88 ILE 88 106 106 ILE ILE A . n A 1 89 LYS 89 107 107 LYS LYS A . n A 1 90 LEU 90 108 108 LEU LEU A . n A 1 91 SER 91 109 109 SER SER A . n A 1 92 SER 92 110 110 SER SER A . n A 1 93 PRO 93 111 111 PRO PRO A . n A 1 94 VAL 94 112 112 VAL VAL A . n A 1 95 LYS 95 113 113 LYS LYS A . n A 1 96 LEU 96 114 114 LEU LEU A . n A 1 97 ASN 97 115 115 ASN ASN A . n A 1 98 ALA 98 116 116 ALA ALA A . n A 1 99 ARG 99 117 117 ARG ARG A . n A 1 100 VAL 100 118 118 VAL VAL A . n A 1 101 ALA 101 119 119 ALA ALA A . n A 1 102 THR 102 120 120 THR THR A . n A 1 103 VAL 103 121 121 VAL VAL A . n A 1 104 ALA 104 122 122 ALA ALA A . n A 1 105 LEU 105 123 123 LEU LEU A . n A 1 106 PRO 106 124 124 PRO PRO A . n A 1 107 SER 107 125 125 SER SER A . n A 1 108 SER 108 127 127 SER SER A . n A 1 109 CYS 109 128 128 CYS CYS A . n A 1 110 ALA 110 129 129 ALA ALA A . n A 1 111 PRO 111 130 130 PRO PRO A . n A 1 112 ALA 112 132 132 ALA ALA A . n A 1 113 GLY 113 133 133 GLY GLY A . n A 1 114 THR 114 134 134 THR THR A . n A 1 115 GLN 115 135 135 GLN GLN A . n A 1 116 CYS 116 136 136 CYS CYS A . n A 1 117 LEU 117 137 137 LEU LEU A . n A 1 118 ILE 118 138 138 ILE ILE A . n A 1 119 SER 119 139 139 SER SER A . n A 1 120 GLY 120 140 140 GLY GLY A . n A 1 121 TRP 121 141 141 TRP TRP A . n A 1 122 GLY 122 142 142 GLY GLY A . n A 1 123 ASN 123 143 143 ASN ASN A . n A 1 124 THR 124 144 144 THR THR A . n A 1 125 LEU 125 145 145 LEU LEU A . n A 1 126 SER 126 146 146 SER SER A . n A 1 127 SER 127 147 147 SER SER A . n A 1 128 GLY 128 148 148 GLY GLY A . n A 1 129 VAL 129 149 149 VAL VAL A . n A 1 130 ASN 130 150 150 ASN ASN A . n A 1 131 GLU 131 151 151 GLU GLU A . n A 1 132 PRO 132 152 152 PRO PRO A . n A 1 133 ASP 133 153 153 ASP ASP A . n A 1 134 LEU 134 154 154 LEU LEU A . n A 1 135 LEU 135 155 155 LEU LEU A . n A 1 136 GLN 136 156 156 GLN GLN A . n A 1 137 CYS 137 157 157 CYS CYS A . n A 1 138 LEU 138 158 158 LEU LEU A . n A 1 139 ASP 139 159 159 ASP ASP A . n A 1 140 ALA 140 160 160 ALA ALA A . n A 1 141 PRO 141 161 161 PRO PRO A . n A 1 142 LEU 142 162 162 LEU LEU A . n A 1 143 LEU 143 163 163 LEU LEU A . n A 1 144 PRO 144 164 164 PRO PRO A . n A 1 145 GLN 145 165 165 GLN GLN A . n A 1 146 ALA 146 166 166 ALA ALA A . n A 1 147 ASP 147 167 167 ASP ASP A . n A 1 148 CYS 148 168 168 CYS CYS A . n A 1 149 GLU 149 169 169 GLU GLU A . n A 1 150 ALA 150 170 170 ALA ALA A . n A 1 151 SER 151 171 171 SER SER A . n A 1 152 TYR 152 172 172 TYR TYR A . n A 1 153 PRO 153 173 173 PRO PRO A . n A 1 154 GLY 154 174 174 GLY GLY A . n A 1 155 LYS 155 175 175 LYS LYS A . n A 1 156 ILE 156 176 176 ILE ILE A . n A 1 157 THR 157 177 177 THR THR A . n A 1 158 ASP 158 178 178 ASP ASP A . n A 1 159 ASN 159 179 179 ASN ASN A . n A 1 160 MET 160 180 180 MET MET A . n A 1 161 VAL 161 181 181 VAL VAL A . n A 1 162 CYS 162 182 182 CYS CYS A . n A 1 163 VAL 163 183 183 VAL VAL A . n A 1 164 GLY 164 184 184 GLY GLY A . n A 1 165 PHE 165 184 184 PHE PHE A A n A 1 166 LEU 166 185 185 LEU LEU A . n A 1 167 GLU 167 186 186 GLU GLU A . n A 1 168 GLY 168 187 187 GLY GLY A . n A 1 169 GLY 169 188 188 GLY GLY A . n A 1 170 LYS 170 188 188 LYS LYS A A n A 1 171 GLY 171 189 189 GLY GLY A . n A 1 172 SER 172 190 190 SER SER A . n A 1 173 CYS 173 191 191 CYS CYS A . n A 1 174 GLN 174 192 192 GLN GLN A . n A 1 175 GLY 175 193 193 GLY GLY A . n A 1 176 ASP 176 194 194 ASP ASP A . n A 1 177 SER 177 195 195 SER SER A . n A 1 178 GLY 178 196 196 GLY GLY A . n A 1 179 GLY 179 197 197 GLY GLY A . n A 1 180 PRO 180 198 198 PRO PRO A . n A 1 181 VAL 181 199 199 VAL VAL A . n A 1 182 VAL 182 200 200 VAL VAL A . n A 1 183 CYS 183 201 201 CYS CYS A . n A 1 184 ASN 184 202 202 ASN ASN A . n A 1 185 GLY 185 203 203 GLY GLY A . n A 1 186 GLU 186 204 204 GLU GLU A . n A 1 187 LEU 187 209 209 LEU LEU A . n A 1 188 GLN 188 210 210 GLN GLN A . n A 1 189 GLY 189 211 211 GLY GLY A . n A 1 190 ILE 190 212 212 ILE ILE A . n A 1 191 VAL 191 213 213 VAL VAL A . n A 1 192 SER 192 214 214 SER SER A . n A 1 193 TRP 193 215 215 TRP TRP A . n A 1 194 GLY 194 216 216 GLY GLY A . n A 1 195 TYR 195 217 217 TYR TYR A . n A 1 196 GLY 196 219 219 GLY GLY A . n A 1 197 CYS 197 220 220 CYS CYS A . n A 1 198 ALA 198 221 221 ALA ALA A . n A 1 199 LEU 199 221 221 LEU LEU A A n A 1 200 PRO 200 222 222 PRO PRO A . n A 1 201 ASP 201 223 223 ASP ASP A . n A 1 202 ASN 202 224 224 ASN ASN A . n A 1 203 PRO 203 225 225 PRO PRO A . n A 1 204 ASP 204 226 226 ASP ASP A . n A 1 205 VAL 205 227 227 VAL VAL A . n A 1 206 TYR 206 228 228 TYR TYR A . n A 1 207 THR 207 229 229 THR THR A . n A 1 208 LYS 208 230 230 LYS LYS A . n A 1 209 VAL 209 231 231 VAL VAL A . n A 1 210 CYS 210 232 232 CYS CYS A . n A 1 211 ASN 211 233 233 ASN ASN A . n A 1 212 TYR 212 234 234 TYR TYR A . n A 1 213 VAL 213 235 235 VAL VAL A . n A 1 214 ASP 214 236 236 ASP ASP A . n A 1 215 TRP 215 237 237 TRP TRP A . n A 1 216 ILE 216 238 238 ILE ILE A . n A 1 217 GLN 217 239 239 GLN GLN A . n A 1 218 ASP 218 240 240 ASP ASP A . n A 1 219 THR 219 241 241 THR THR A . n A 1 220 ILE 220 242 242 ILE ILE A . n A 1 221 ALA 221 243 243 ALA ALA A . n A 1 222 ALA 222 244 244 ALA ALA A . n A 1 223 ASN 223 245 245 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 302 302 CA CA A . C 3 BEN 1 246 246 BEN BEN A . D 4 HOH 1 248 248 HOH HOH A . D 4 HOH 2 249 249 HOH HOH A . D 4 HOH 3 250 250 HOH HOH A . D 4 HOH 4 251 251 HOH HOH A . D 4 HOH 5 252 252 HOH HOH A . D 4 HOH 6 253 253 HOH HOH A . D 4 HOH 7 254 254 HOH HOH A . D 4 HOH 8 255 255 HOH HOH A . D 4 HOH 9 256 256 HOH HOH A . D 4 HOH 10 257 257 HOH HOH A . D 4 HOH 11 258 258 HOH HOH A . D 4 HOH 12 259 259 HOH HOH A . D 4 HOH 13 260 260 HOH HOH A . D 4 HOH 14 261 261 HOH HOH A . D 4 HOH 15 262 262 HOH HOH A . D 4 HOH 16 263 263 HOH HOH A . D 4 HOH 17 264 264 HOH HOH A . D 4 HOH 18 265 265 HOH HOH A . D 4 HOH 19 266 266 HOH HOH A . D 4 HOH 20 267 267 HOH HOH A . D 4 HOH 21 268 268 HOH HOH A . D 4 HOH 22 269 269 HOH HOH A . D 4 HOH 23 270 270 HOH HOH A . D 4 HOH 24 271 271 HOH HOH A . D 4 HOH 25 272 272 HOH HOH A . D 4 HOH 26 273 273 HOH HOH A . D 4 HOH 27 275 275 HOH HOH A . D 4 HOH 28 276 276 HOH HOH A . D 4 HOH 29 277 277 HOH HOH A . D 4 HOH 30 278 278 HOH HOH A . D 4 HOH 31 279 279 HOH HOH A . D 4 HOH 32 280 280 HOH HOH A . D 4 HOH 33 281 281 HOH HOH A . D 4 HOH 34 282 282 HOH HOH A . D 4 HOH 35 283 283 HOH HOH A . D 4 HOH 36 284 284 HOH HOH A . D 4 HOH 37 285 285 HOH HOH A . D 4 HOH 38 286 286 HOH HOH A . D 4 HOH 39 287 287 HOH HOH A . D 4 HOH 40 288 288 HOH HOH A . D 4 HOH 41 289 289 HOH HOH A . D 4 HOH 42 290 290 HOH HOH A . D 4 HOH 43 291 291 HOH HOH A . D 4 HOH 44 292 292 HOH HOH A . D 4 HOH 45 293 293 HOH HOH A . D 4 HOH 46 294 294 HOH HOH A . D 4 HOH 47 295 295 HOH HOH A . D 4 HOH 48 296 296 HOH HOH A . D 4 HOH 49 297 297 HOH HOH A . D 4 HOH 50 298 298 HOH HOH A . D 4 HOH 51 300 300 HOH HOH A . D 4 HOH 52 301 301 HOH HOH A . D 4 HOH 53 303 303 HOH HOH A . D 4 HOH 54 304 304 HOH HOH A . D 4 HOH 55 305 305 HOH HOH A . D 4 HOH 56 306 306 HOH HOH A . D 4 HOH 57 307 307 HOH HOH A . D 4 HOH 58 308 308 HOH HOH A . D 4 HOH 59 309 309 HOH HOH A . D 4 HOH 60 310 310 HOH HOH A . D 4 HOH 61 311 311 HOH HOH A . D 4 HOH 62 312 312 HOH HOH A . D 4 HOH 63 313 313 HOH HOH A . D 4 HOH 64 314 314 HOH HOH A . D 4 HOH 65 315 315 HOH HOH A . D 4 HOH 66 316 316 HOH HOH A . D 4 HOH 67 317 317 HOH HOH A . D 4 HOH 68 318 318 HOH HOH A . D 4 HOH 69 319 319 HOH HOH A . D 4 HOH 70 320 320 HOH HOH A . D 4 HOH 71 321 321 HOH HOH A . D 4 HOH 72 322 322 HOH HOH A . D 4 HOH 73 323 323 HOH HOH A . D 4 HOH 74 324 324 HOH HOH A . D 4 HOH 75 327 327 HOH HOH A . D 4 HOH 76 328 328 HOH HOH A . D 4 HOH 77 329 329 HOH HOH A . D 4 HOH 78 330 330 HOH HOH A . D 4 HOH 79 332 332 HOH HOH A . D 4 HOH 80 333 333 HOH HOH A . D 4 HOH 81 335 335 HOH HOH A . D 4 HOH 82 336 336 HOH HOH A . D 4 HOH 83 338 338 HOH HOH A . D 4 HOH 84 339 339 HOH HOH A . D 4 HOH 85 340 340 HOH HOH A . D 4 HOH 86 341 341 HOH HOH A . D 4 HOH 87 342 342 HOH HOH A . D 4 HOH 88 343 343 HOH HOH A . D 4 HOH 89 344 344 HOH HOH A . D 4 HOH 90 345 345 HOH HOH A . D 4 HOH 91 346 346 HOH HOH A . D 4 HOH 92 347 347 HOH HOH A . D 4 HOH 93 348 348 HOH HOH A . D 4 HOH 94 349 349 HOH HOH A . D 4 HOH 95 350 350 HOH HOH A . D 4 HOH 96 351 351 HOH HOH A . D 4 HOH 97 352 352 HOH HOH A . D 4 HOH 98 353 353 HOH HOH A . D 4 HOH 99 354 354 HOH HOH A . D 4 HOH 100 355 355 HOH HOH A . D 4 HOH 101 356 356 HOH HOH A . D 4 HOH 102 357 357 HOH HOH A . D 4 HOH 103 358 358 HOH HOH A . D 4 HOH 104 359 359 HOH HOH A . D 4 HOH 105 360 360 HOH HOH A . D 4 HOH 106 361 361 HOH HOH A . D 4 HOH 107 362 362 HOH HOH A . D 4 HOH 108 363 363 HOH HOH A . D 4 HOH 109 364 364 HOH HOH A . D 4 HOH 110 365 365 HOH HOH A . D 4 HOH 111 366 366 HOH HOH A . D 4 HOH 112 367 367 HOH HOH A . D 4 HOH 113 368 368 HOH HOH A . D 4 HOH 114 369 369 HOH HOH A . D 4 HOH 115 370 370 HOH HOH A . D 4 HOH 116 371 371 HOH HOH A . D 4 HOH 117 372 372 HOH HOH A . D 4 HOH 118 373 373 HOH HOH A . D 4 HOH 119 374 374 HOH HOH A . D 4 HOH 120 375 375 HOH HOH A . D 4 HOH 121 376 376 HOH HOH A . D 4 HOH 122 377 377 HOH HOH A . D 4 HOH 123 378 378 HOH HOH A . D 4 HOH 124 379 379 HOH HOH A . D 4 HOH 125 380 380 HOH HOH A . D 4 HOH 126 381 381 HOH HOH A . D 4 HOH 127 382 382 HOH HOH A . D 4 HOH 128 383 383 HOH HOH A . D 4 HOH 129 384 384 HOH HOH A . D 4 HOH 130 385 385 HOH HOH A . D 4 HOH 131 386 386 HOH HOH A . D 4 HOH 132 387 387 HOH HOH A . D 4 HOH 133 388 388 HOH HOH A . D 4 HOH 134 389 389 HOH HOH A . D 4 HOH 135 390 390 HOH HOH A . D 4 HOH 136 391 391 HOH HOH A . D 4 HOH 137 392 392 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 124.4000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 O ? A VAL 57 ? A VAL 75 ? 1_555 165.2 ? 2 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 OE1 ? A GLU 59 ? A GLU 77 ? 1_555 93.9 ? 3 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 OE1 ? A GLU 59 ? A GLU 77 ? 1_555 95.1 ? 4 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 98.6 ? 5 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 94.2 ? 6 OE1 ? A GLU 59 ? A GLU 77 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 82.9 ? 7 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 261 ? 1_555 79.2 ? 8 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 261 ? 1_555 91.9 ? 9 OE1 ? A GLU 59 ? A GLU 77 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 261 ? 1_555 172.9 ? 10 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 261 ? 1_555 96.7 ? 11 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 O ? A ASN 54 ? A ASN 72 ? 1_555 90.1 ? 12 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 O ? A ASN 54 ? A ASN 72 ? 1_555 78.8 ? 13 OE1 ? A GLU 59 ? A GLU 77 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 O ? A ASN 54 ? A ASN 72 ? 1_555 85.7 ? 14 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 O ? A ASN 54 ? A ASN 72 ? 1_555 166.1 ? 15 O ? D HOH . ? A HOH 261 ? 1_555 CA ? B CA . ? A CA 302 ? 1_555 O ? A ASN 54 ? A ASN 72 ? 1_555 95.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-04-30 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # _software.name PROLSQ _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _pdbx_entry_details.entry_id 1BRA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;BENZAMIDINE IS AN ANALOG OF ARGININE WHICH POSSESSES A POSITIVELY CHARGED AMIDINIUM GROUP RATHER THAN A GUANIDINIUM. TWO BENZAMIDINES ARE MODELLED PER TRYPSIN. BEN 246 BINDS IN THE PRIMARY SPECIFICITY POCKET; BEN 247 BINDS NONSPECIFICALLY ON THE SURFACE OF THE MOLECULE AT A LATTICE CONTACT. RAT TRYPSIN CRYSTALS IN THIS CUBIC SPACE GROUP DO NOT GROW IN THE ABSENCE OF ADDED BENZAMIDINE IN THE CRYSTALLIZATION DROP. ; _pdbx_entry_details.sequence_details ;SEQUENCE ADVISORY NOTICE: SEQUENCE FOR THIS STRUCTURE WAS TAKEN FROM GENEMBL WHICH DIFFERS FROM SWISSPROT SEQUENCE AT POSITIONS 61 AND 65. ; # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 42 ? ? C A CYS 42 ? ? O A CYS 42 ? ? 107.47 120.10 -12.63 2.10 N 2 1 N A ASN 48 ? ? CA A ASN 48 ? ? CB A ASN 48 ? ? 123.55 110.60 12.95 1.80 N 3 1 N A LYS 60 ? ? CA A LYS 60 ? ? CB A LYS 60 ? ? 121.46 110.60 10.86 1.80 N 4 1 NE A ARG 62 ? ? CZ A ARG 62 ? ? NH1 A ARG 62 ? ? 128.49 120.30 8.19 0.50 N 5 1 NE A ARG 62 ? ? CZ A ARG 62 ? ? NH2 A ARG 62 ? ? 111.47 120.30 -8.83 0.50 N 6 1 NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 123.49 120.30 3.19 0.50 N 7 1 CA A ILE 73 ? ? CB A ILE 73 ? ? CG2 A ILE 73 ? ? 123.65 110.90 12.75 2.00 N 8 1 OE1 A GLU 77 ? ? CD A GLU 77 ? ? OE2 A GLU 77 ? ? 134.66 123.30 11.36 1.20 N 9 1 CG A GLU 77 ? ? CD A GLU 77 ? ? OE2 A GLU 77 ? ? 98.57 118.30 -19.73 2.00 N 10 1 CB A PHE 82 ? ? CG A PHE 82 ? ? CD2 A PHE 82 ? ? 114.36 120.80 -6.44 0.70 N 11 1 CB A PHE 82 ? ? CG A PHE 82 ? ? CD1 A PHE 82 ? ? 125.07 120.80 4.27 0.70 N 12 1 CB A ASP 95 ? ? CG A ASP 95 ? ? OD1 A ASP 95 ? ? 124.60 118.30 6.30 0.90 N 13 1 CB A ASP 95 ? ? CG A ASP 95 ? ? OD2 A ASP 95 ? ? 112.60 118.30 -5.70 0.90 N 14 1 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH1 A ARG 96 ? ? 123.59 120.30 3.29 0.50 N 15 1 CB A ASP 102 ? ? CG A ASP 102 ? ? OD1 A ASP 102 ? ? 126.47 118.30 8.17 0.90 N 16 1 CB A ASP 102 ? ? CG A ASP 102 ? ? OD2 A ASP 102 ? ? 112.70 118.30 -5.60 0.90 N 17 1 CA A SER 146 ? ? CB A SER 146 ? ? OG A SER 146 ? ? 91.58 111.20 -19.62 2.70 N 18 1 CA A GLU 151 ? ? CB A GLU 151 ? ? CG A GLU 151 ? ? 100.08 113.40 -13.32 2.20 N 19 1 OE1 A GLU 151 ? ? CD A GLU 151 ? ? OE2 A GLU 151 ? ? 131.54 123.30 8.24 1.20 N 20 1 O A LEU 154 ? ? C A LEU 154 ? ? N A LEU 155 ? ? 132.48 122.70 9.78 1.60 Y 21 1 CB A CYS 168 ? ? CA A CYS 168 ? ? C A CYS 168 ? ? 120.12 111.50 8.62 1.20 N 22 1 CA A ASP 178 ? ? CB A ASP 178 ? ? CG A ASP 178 ? ? 96.00 113.40 -17.40 2.20 N 23 1 CB A ASP 178 ? ? CG A ASP 178 ? ? OD1 A ASP 178 ? ? 108.52 118.30 -9.78 0.90 N 24 1 CB A SER 190 ? ? CA A SER 190 ? ? C A SER 190 ? ? 129.80 110.10 19.70 1.90 N 25 1 CB A ASP 194 ? ? CG A ASP 194 ? ? OD1 A ASP 194 ? ? 112.48 118.30 -5.82 0.90 N 26 1 CB A VAL 199 ? ? CA A VAL 199 ? ? C A VAL 199 ? ? 122.83 111.40 11.43 1.90 N 27 1 N A VAL 199 ? ? CA A VAL 199 ? ? CB A VAL 199 ? ? 125.97 111.50 14.47 2.20 N 28 1 CG1 A VAL 199 ? ? CB A VAL 199 ? ? CG2 A VAL 199 ? ? 122.55 110.90 11.65 1.60 N 29 1 CB A ASP 223 ? ? CG A ASP 223 ? ? OD2 A ASP 223 ? ? 128.07 118.30 9.77 0.90 N 30 1 CB A VAL 227 ? ? CA A VAL 227 ? ? C A VAL 227 ? ? 122.88 111.40 11.48 1.90 N 31 1 CA A THR 229 ? ? CB A THR 229 ? ? OG1 A THR 229 ? ? 95.61 109.00 -13.39 2.10 N 32 1 CB A ASP 240 ? ? CG A ASP 240 ? ? OD1 A ASP 240 ? ? 125.19 118.30 6.89 0.90 N 33 1 CB A ASP 240 ? ? CG A ASP 240 ? ? OD2 A ASP 240 ? ? 112.41 118.30 -5.89 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 71 ? ? -128.89 -71.17 2 1 ASN A 115 ? ? -152.95 -155.66 3 1 SER A 214 ? ? -121.64 -63.05 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 BENZAMIDINE BEN 4 water HOH #