data_1C8F # _entry.id 1C8F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.368 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1C8F pdb_00001c8f 10.2210/pdb1c8f/pdb RCSB RCSB001464 ? ? WWPDB D_1000001464 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1IJS 'contains an unrefined version of this structure' unspecified PDB 4DPV 'contains the wild type form of this virus' unspecified PDB 2CAS 'contains the wild type form of this virus' unspecified PDB 1FPV 'contains the closely related Feline Panleukopenia virus' unspecified PDB 1MVM 'contains the related Minute Virus of Mouse' unspecified PDB 1C8D 'contains the refined structure of A300D mutant of Canine Parvovirus' unspecified PDB 1C8E 'contains the closely related Feline Panleukopenia Virus, in the presence of EDTA' unspecified PDB 1C8G 'contains the structure of Feline Panleukopenia Virus at pH 6.2' unspecified PDB 1C8H 'contains the refined structure of Canine Parvovirus at pH 5.5' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1C8F _pdbx_database_status.recvd_initial_deposition_date 2000-05-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rossmann, M.G.' 1 'Simpson, A.A.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Host range and variability of calcium binding by surface loops in the capsids of canine and feline parvoviruses.' J.Mol.Biol. 300 597 610 2000 JMOBAK UK 0022-2836 0070 ? 10884355 10.1006/jmbi.2000.3868 1 'Structure Determination of Feline Panleukopenia Virus Empty Particles' 'Protein Sci.' 16 155 171 1993 PRCIEI US 0961-8368 0795 ? ? ? 2 ;Structural Refinement of the DNA-Containing Capsid of Canine Parvovirus using RSRef, a Resolution-Dependent Stereochemically Restrained Real-Space Refinement Method ; 'Acta Crystallogr.,Sect.D' 52 129 142 1996 ABCRE6 DK 0907-4449 0766 ? ? 10.1107/S0907444995007268 3 'Structural Analysis of a Mutation in Canine Parvovirus which Controls Antigenicity and Host Range' Virology 225 65 71 1996 VIRLAX US 0042-6822 0922 ? ? 10.1006/viro.1996.0575 4 'The Three-Dimensional Structure of Canine Parvovirus and its Functional Implications' Science 251 1456 1464 1991 SCIEAS US 0036-8075 0038 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Simpson, A.A.' 1 ? primary 'Chandrasekar, V.' 2 ? primary 'Hebert, B.' 3 ? primary 'Sullivan, G.M.' 4 ? primary 'Rossmann, M.G.' 5 ? primary 'Parrish, C.R.' 6 ? 1 'Agbandje, M.' 7 ? 1 'McKenna, R.' 8 ? 1 'Rossmann, M.G.' 9 ? 1 'Strassheim, M.L.' 10 ? 1 'Parrish, C.R.' 11 ? 2 'Chapman, M.S.' 12 ? 2 'Rossmann, M.G.' 13 ? 3 'Llamas-Saiz, A.L.' 14 ? 3 'Agbandje-McKenna, M.' 15 ? 3 'Parker, J.S.' 16 ? 3 'Wahid, A.T.' 17 ? 3 'Parrish, C.R.' 18 ? 3 'Rossmann, M.G.' 19 ? 4 'Tsao, J.' 20 ? 4 'Chapman, M.S.' 21 ? 4 'Agbandje, M.' 22 ? 4 'Keller, W.' 23 ? 4 'Smith, K.' 24 ? 4 'Wu, H.' 25 ? 4 'Luo, M.' 26 ? 4 'Smith, T.J.' 27 ? 4 'Rossmann, M.G.' 28 ? 4 'Compans, R.W.' 29 ? 4 'Parrish, C.R.' 30 ? # _cell.entry_id 1C8F _cell.length_a 380.12 _cell.length_b 379.25 _cell.length_c 350.82 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 240 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1C8F _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'FELINE PANLEUKOPENIA VIRUS CAPSID' 61620.500 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 3 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYKRVVVNNMDKTAVKGNMALDDIHVEIVTPWSLVDANA WGVWFNPGDWQLIVNTMSELHLVSFEQEIFNVVLKTVSESATQPPTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLG FYPWKPTIPTPWRYYFQWDRTLIPSHTGTSGTPTNVYHGTDPDDVQFYTIENSVPVHLLRTGDEFATGTFFFDCKPCRLT HTWQTNRALGLPPFLNSLPQSEGATNFGDIGVQQDKRRGVTQMGNTDYITEATIMRPAEVGYSAPYYSFEASTQGPFKTP IAAGRGGAQTDENQAADGDPRYAFGRQHGQKTTTTGETPERFTYIAHQDTGRYPEGDWIQNINFNLPVTNDNVLLPTDPI GGKTGINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKPRLHINAPFVCQNNCPGQLFVKVAPNLTNQYDPDASA NMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQMSINVDNQFNYVPNNIGAMKIVYEKSQLAPRKLY ; _entity_poly.pdbx_seq_one_letter_code_can ;GVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYKRVVVNNMDKTAVKGNMALDDIHVEIVTPWSLVDANA WGVWFNPGDWQLIVNTMSELHLVSFEQEIFNVVLKTVSESATQPPTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLG FYPWKPTIPTPWRYYFQWDRTLIPSHTGTSGTPTNVYHGTDPDDVQFYTIENSVPVHLLRTGDEFATGTFFFDCKPCRLT HTWQTNRALGLPPFLNSLPQSEGATNFGDIGVQQDKRRGVTQMGNTDYITEATIMRPAEVGYSAPYYSFEASTQGPFKTP IAAGRGGAQTDENQAADGDPRYAFGRQHGQKTTTTGETPERFTYIAHQDTGRYPEGDWIQNINFNLPVTNDNVLLPTDPI GGKTGINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKPRLHINAPFVCQNNCPGQLFVKVAPNLTNQYDPDASA NMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQMSINVDNQFNYVPNNIGAMKIVYEKSQLAPRKLY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 VAL n 1 3 GLY n 1 4 ILE n 1 5 SER n 1 6 THR n 1 7 GLY n 1 8 THR n 1 9 PHE n 1 10 ASN n 1 11 ASN n 1 12 GLN n 1 13 THR n 1 14 GLU n 1 15 PHE n 1 16 LYS n 1 17 PHE n 1 18 LEU n 1 19 GLU n 1 20 ASN n 1 21 GLY n 1 22 TRP n 1 23 VAL n 1 24 GLU n 1 25 ILE n 1 26 THR n 1 27 ALA n 1 28 ASN n 1 29 SER n 1 30 SER n 1 31 ARG n 1 32 LEU n 1 33 VAL n 1 34 HIS n 1 35 LEU n 1 36 ASN n 1 37 MET n 1 38 PRO n 1 39 GLU n 1 40 SER n 1 41 GLU n 1 42 ASN n 1 43 TYR n 1 44 LYS n 1 45 ARG n 1 46 VAL n 1 47 VAL n 1 48 VAL n 1 49 ASN n 1 50 ASN n 1 51 MET n 1 52 ASP n 1 53 LYS n 1 54 THR n 1 55 ALA n 1 56 VAL n 1 57 LYS n 1 58 GLY n 1 59 ASN n 1 60 MET n 1 61 ALA n 1 62 LEU n 1 63 ASP n 1 64 ASP n 1 65 ILE n 1 66 HIS n 1 67 VAL n 1 68 GLU n 1 69 ILE n 1 70 VAL n 1 71 THR n 1 72 PRO n 1 73 TRP n 1 74 SER n 1 75 LEU n 1 76 VAL n 1 77 ASP n 1 78 ALA n 1 79 ASN n 1 80 ALA n 1 81 TRP n 1 82 GLY n 1 83 VAL n 1 84 TRP n 1 85 PHE n 1 86 ASN n 1 87 PRO n 1 88 GLY n 1 89 ASP n 1 90 TRP n 1 91 GLN n 1 92 LEU n 1 93 ILE n 1 94 VAL n 1 95 ASN n 1 96 THR n 1 97 MET n 1 98 SER n 1 99 GLU n 1 100 LEU n 1 101 HIS n 1 102 LEU n 1 103 VAL n 1 104 SER n 1 105 PHE n 1 106 GLU n 1 107 GLN n 1 108 GLU n 1 109 ILE n 1 110 PHE n 1 111 ASN n 1 112 VAL n 1 113 VAL n 1 114 LEU n 1 115 LYS n 1 116 THR n 1 117 VAL n 1 118 SER n 1 119 GLU n 1 120 SER n 1 121 ALA n 1 122 THR n 1 123 GLN n 1 124 PRO n 1 125 PRO n 1 126 THR n 1 127 LYS n 1 128 VAL n 1 129 TYR n 1 130 ASN n 1 131 ASN n 1 132 ASP n 1 133 LEU n 1 134 THR n 1 135 ALA n 1 136 SER n 1 137 LEU n 1 138 MET n 1 139 VAL n 1 140 ALA n 1 141 LEU n 1 142 ASP n 1 143 SER n 1 144 ASN n 1 145 ASN n 1 146 THR n 1 147 MET n 1 148 PRO n 1 149 PHE n 1 150 THR n 1 151 PRO n 1 152 ALA n 1 153 ALA n 1 154 MET n 1 155 ARG n 1 156 SER n 1 157 GLU n 1 158 THR n 1 159 LEU n 1 160 GLY n 1 161 PHE n 1 162 TYR n 1 163 PRO n 1 164 TRP n 1 165 LYS n 1 166 PRO n 1 167 THR n 1 168 ILE n 1 169 PRO n 1 170 THR n 1 171 PRO n 1 172 TRP n 1 173 ARG n 1 174 TYR n 1 175 TYR n 1 176 PHE n 1 177 GLN n 1 178 TRP n 1 179 ASP n 1 180 ARG n 1 181 THR n 1 182 LEU n 1 183 ILE n 1 184 PRO n 1 185 SER n 1 186 HIS n 1 187 THR n 1 188 GLY n 1 189 THR n 1 190 SER n 1 191 GLY n 1 192 THR n 1 193 PRO n 1 194 THR n 1 195 ASN n 1 196 VAL n 1 197 TYR n 1 198 HIS n 1 199 GLY n 1 200 THR n 1 201 ASP n 1 202 PRO n 1 203 ASP n 1 204 ASP n 1 205 VAL n 1 206 GLN n 1 207 PHE n 1 208 TYR n 1 209 THR n 1 210 ILE n 1 211 GLU n 1 212 ASN n 1 213 SER n 1 214 VAL n 1 215 PRO n 1 216 VAL n 1 217 HIS n 1 218 LEU n 1 219 LEU n 1 220 ARG n 1 221 THR n 1 222 GLY n 1 223 ASP n 1 224 GLU n 1 225 PHE n 1 226 ALA n 1 227 THR n 1 228 GLY n 1 229 THR n 1 230 PHE n 1 231 PHE n 1 232 PHE n 1 233 ASP n 1 234 CYS n 1 235 LYS n 1 236 PRO n 1 237 CYS n 1 238 ARG n 1 239 LEU n 1 240 THR n 1 241 HIS n 1 242 THR n 1 243 TRP n 1 244 GLN n 1 245 THR n 1 246 ASN n 1 247 ARG n 1 248 ALA n 1 249 LEU n 1 250 GLY n 1 251 LEU n 1 252 PRO n 1 253 PRO n 1 254 PHE n 1 255 LEU n 1 256 ASN n 1 257 SER n 1 258 LEU n 1 259 PRO n 1 260 GLN n 1 261 SER n 1 262 GLU n 1 263 GLY n 1 264 ALA n 1 265 THR n 1 266 ASN n 1 267 PHE n 1 268 GLY n 1 269 ASP n 1 270 ILE n 1 271 GLY n 1 272 VAL n 1 273 GLN n 1 274 GLN n 1 275 ASP n 1 276 LYS n 1 277 ARG n 1 278 ARG n 1 279 GLY n 1 280 VAL n 1 281 THR n 1 282 GLN n 1 283 MET n 1 284 GLY n 1 285 ASN n 1 286 THR n 1 287 ASP n 1 288 TYR n 1 289 ILE n 1 290 THR n 1 291 GLU n 1 292 ALA n 1 293 THR n 1 294 ILE n 1 295 MET n 1 296 ARG n 1 297 PRO n 1 298 ALA n 1 299 GLU n 1 300 VAL n 1 301 GLY n 1 302 TYR n 1 303 SER n 1 304 ALA n 1 305 PRO n 1 306 TYR n 1 307 TYR n 1 308 SER n 1 309 PHE n 1 310 GLU n 1 311 ALA n 1 312 SER n 1 313 THR n 1 314 GLN n 1 315 GLY n 1 316 PRO n 1 317 PHE n 1 318 LYS n 1 319 THR n 1 320 PRO n 1 321 ILE n 1 322 ALA n 1 323 ALA n 1 324 GLY n 1 325 ARG n 1 326 GLY n 1 327 GLY n 1 328 ALA n 1 329 GLN n 1 330 THR n 1 331 ASP n 1 332 GLU n 1 333 ASN n 1 334 GLN n 1 335 ALA n 1 336 ALA n 1 337 ASP n 1 338 GLY n 1 339 ASP n 1 340 PRO n 1 341 ARG n 1 342 TYR n 1 343 ALA n 1 344 PHE n 1 345 GLY n 1 346 ARG n 1 347 GLN n 1 348 HIS n 1 349 GLY n 1 350 GLN n 1 351 LYS n 1 352 THR n 1 353 THR n 1 354 THR n 1 355 THR n 1 356 GLY n 1 357 GLU n 1 358 THR n 1 359 PRO n 1 360 GLU n 1 361 ARG n 1 362 PHE n 1 363 THR n 1 364 TYR n 1 365 ILE n 1 366 ALA n 1 367 HIS n 1 368 GLN n 1 369 ASP n 1 370 THR n 1 371 GLY n 1 372 ARG n 1 373 TYR n 1 374 PRO n 1 375 GLU n 1 376 GLY n 1 377 ASP n 1 378 TRP n 1 379 ILE n 1 380 GLN n 1 381 ASN n 1 382 ILE n 1 383 ASN n 1 384 PHE n 1 385 ASN n 1 386 LEU n 1 387 PRO n 1 388 VAL n 1 389 THR n 1 390 ASN n 1 391 ASP n 1 392 ASN n 1 393 VAL n 1 394 LEU n 1 395 LEU n 1 396 PRO n 1 397 THR n 1 398 ASP n 1 399 PRO n 1 400 ILE n 1 401 GLY n 1 402 GLY n 1 403 LYS n 1 404 THR n 1 405 GLY n 1 406 ILE n 1 407 ASN n 1 408 TYR n 1 409 THR n 1 410 ASN n 1 411 ILE n 1 412 PHE n 1 413 ASN n 1 414 THR n 1 415 TYR n 1 416 GLY n 1 417 PRO n 1 418 LEU n 1 419 THR n 1 420 ALA n 1 421 LEU n 1 422 ASN n 1 423 ASN n 1 424 VAL n 1 425 PRO n 1 426 PRO n 1 427 VAL n 1 428 TYR n 1 429 PRO n 1 430 ASN n 1 431 GLY n 1 432 GLN n 1 433 ILE n 1 434 TRP n 1 435 ASP n 1 436 LYS n 1 437 GLU n 1 438 PHE n 1 439 ASP n 1 440 THR n 1 441 ASP n 1 442 LEU n 1 443 LYS n 1 444 PRO n 1 445 ARG n 1 446 LEU n 1 447 HIS n 1 448 ILE n 1 449 ASN n 1 450 ALA n 1 451 PRO n 1 452 PHE n 1 453 VAL n 1 454 CYS n 1 455 GLN n 1 456 ASN n 1 457 ASN n 1 458 CYS n 1 459 PRO n 1 460 GLY n 1 461 GLN n 1 462 LEU n 1 463 PHE n 1 464 VAL n 1 465 LYS n 1 466 VAL n 1 467 ALA n 1 468 PRO n 1 469 ASN n 1 470 LEU n 1 471 THR n 1 472 ASN n 1 473 GLN n 1 474 TYR n 1 475 ASP n 1 476 PRO n 1 477 ASP n 1 478 ALA n 1 479 SER n 1 480 ALA n 1 481 ASN n 1 482 MET n 1 483 SER n 1 484 ARG n 1 485 ILE n 1 486 VAL n 1 487 THR n 1 488 TYR n 1 489 SER n 1 490 ASP n 1 491 PHE n 1 492 TRP n 1 493 TRP n 1 494 LYS n 1 495 GLY n 1 496 LYS n 1 497 LEU n 1 498 VAL n 1 499 PHE n 1 500 LYS n 1 501 ALA n 1 502 LYS n 1 503 LEU n 1 504 ARG n 1 505 ALA n 1 506 SER n 1 507 HIS n 1 508 THR n 1 509 TRP n 1 510 ASN n 1 511 PRO n 1 512 ILE n 1 513 GLN n 1 514 GLN n 1 515 MET n 1 516 SER n 1 517 ILE n 1 518 ASN n 1 519 VAL n 1 520 ASP n 1 521 ASN n 1 522 GLN n 1 523 PHE n 1 524 ASN n 1 525 TYR n 1 526 VAL n 1 527 PRO n 1 528 ASN n 1 529 ASN n 1 530 ILE n 1 531 GLY n 1 532 ALA n 1 533 MET n 1 534 LYS n 1 535 ILE n 1 536 VAL n 1 537 TYR n 1 538 GLU n 1 539 LYS n 1 540 SER n 1 541 GLN n 1 542 LEU n 1 543 ALA n 1 544 PRO n 1 545 ARG n 1 546 LYS n 1 547 LEU n 1 548 TYR n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Feline panleukopenia virus' _entity_src_nat.pdbx_ncbi_taxonomy_id 10786 _entity_src_nat.genus Parvovirus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_code COAT_FPV19 _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P24840 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1C8F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 548 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P24840 _struct_ref_seq.db_align_beg 37 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 584 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 37 _struct_ref_seq.pdbx_auth_seq_align_end 584 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1C8F ILE A 65 ? UNP P24840 THR 101 conflict 101 1 1 1C8F GLU A 68 ? UNP P24840 GLN 104 conflict 104 2 1 1C8F VAL A 196 ? UNP P24840 ILE 232 conflict 232 3 1 1C8F ILE A 448 ? UNP P24840 VAL 484 conflict 484 4 1 1C8F GLN A 473 ? UNP P24840 GLU 509 conflict 509 5 1 1C8F VAL A 526 ? UNP P24840 LEU 562 conflict 562 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1C8F _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.75-1.5% PEG8000, 8 mM CaCl2, 20 mM Tris pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 277 ? 1 2 ? ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 'OSCILLATION CAMERA' ? 1992-01-15 ? 2 'OSCILLATION CAMERA' ? 1993-01-15 ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9 1.0 2 1.4 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'CHESS BEAMLINE F1' _diffrn_source.pdbx_synchrotron_site CHESS _diffrn_source.pdbx_synchrotron_beamline F1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.9, 1.4' # _reflns.entry_id 1C8F _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 37.8 _reflns.d_resolution_high 2.7 _reflns.number_obs 547268 _reflns.number_all 918139 _reflns.percent_possible_obs 59.6 _reflns.pdbx_Rmerge_I_obs 0.146 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.2 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.0 _reflns_shell.d_res_low 3.2 _reflns_shell.percent_possible_all 35 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.number_unique_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1C8F _refine.ls_number_reflns_obs 547268 _refine.ls_number_reflns_all 918139 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 9.0 _refine.ls_d_res_high 3.0 _refine.ls_percent_reflns_obs 59.6 _refine.ls_R_factor_obs 0.285 _refine.ls_R_factor_all 0.285 _refine.ls_R_factor_R_work 0.285 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 0 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details 'restrained least squares with strictly enforced icosahedral symmetry' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 4351 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 4354 _refine_hist.d_res_high 3.0 _refine_hist.d_res_low 9.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008638 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.589 ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.details _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] 1 given ? 1.00000000 0.00000000 0.00000000 0.00000000 1.00000000 0.00000000 0.00000000 0.00000000 1.00000000 0.00000 0.00000 0.00000 2 generate ? 0.68792132 0.65148640 -0.31989009 -0.62593677 0.30944772 -0.71585290 -0.36737919 0.69268137 0.62066495 60.66790 118.90606 71.31510 3 generate ? 0.18296741 0.42819046 -0.88497222 -0.36130050 -0.80788937 -0.46559288 -0.91432211 0.40492916 0.00688798 157.05533 66.67589 175.65377 4 generate ? 0.18296741 -0.36130042 -0.91432208 0.42819050 -0.80788939 0.40492923 -0.88497223 -0.46559284 0.00688800 155.95814 -84.51020 168.82352 5 generate ? 0.68792132 -0.62593667 -0.36737917 0.65148649 0.30944768 0.69268145 -0.31989008 -0.71585283 0.62066498 58.89261 -125.71817 60.26352 6 generate ? -0.65122136 -0.32572784 -0.68542841 -0.32572788 -0.69579950 0.64012848 -0.68542841 0.64012840 0.34702085 115.62510 -125.27427 118.36814 7 generate ? 0.00770812 -0.99984108 0.01607110 -0.02371855 0.01588422 0.99959252 -0.99968897 -0.00808614 -0.02359234 -11.49553 -182.11945 177.64761 8 generate ? 0.62523569 -0.29324466 0.72324816 -0.39348850 0.68186213 0.61662861 -0.67397861 -0.67012798 0.31093615 -128.76895 -110.38363 114.35460 9 generate ? 0.34795926 0.81756918 0.45880811 -0.92402825 0.38177542 0.02047984 -0.15841798 -0.43107779 0.88829931 -74.12727 -9.20328 15.95790 10 generate ? -0.44093459 0.79749347 -0.41180188 -0.88214988 -0.46966630 0.03500356 -0.16549434 0.37870518 0.91060089 76.91656 -18.40620 18.43840 11 generate ? 0.07412105 0.99450294 0.07395834 0.99450307 -0.07921343 0.06847626 0.07395834 0.06847626 -0.99490762 -5.83402 -19.62003 348.55605 12 generate ? -0.59867727 0.40726508 -0.68972506 0.70856571 0.67082504 -0.21892570 0.37352407 -0.61978129 -0.69018175 122.18952 36.17881 290.23325 13 generate ? -0.41337442 -0.74176255 -0.52811913 0.14797215 0.51756045 -0.84275472 0.89845749 -0.42652009 -0.10418603 85.10751 143.31846 189.97804 14 generate ? 0.37394737 -0.86466282 0.33544222 0.08744363 -0.32720075 -0.94090028 0.92331846 0.38117945 -0.04674663 -65.83398 153.73556 186.33971 15 generate ? 0.67523614 0.20840827 0.70754657 0.61062851 -0.69602728 -0.37772857 0.41374995 0.68710401 -0.59724284 -122.03894 53.03403 284.34630 16 generate ? -0.42289969 -0.66877511 0.61147007 -0.66877519 -0.22498707 -0.70860474 0.61147007 -0.70860465 -0.35211323 -113.09508 113.39830 230.76382 17 generate ? -0.09695216 -0.05891041 0.99354406 -0.05891039 -0.99615697 -0.06481391 0.99354409 -0.06481393 0.09310914 -174.66589 -4.46143 158.49204 18 generate ? -0.39482869 0.60681675 0.68984320 0.60681685 -0.39153321 0.69171899 0.68984323 0.69171890 -0.21363810 -116.69788 -131.10671 217.70159 19 generate ? -0.90487404 0.40839406 0.12007174 0.40839413 0.75331472 0.51549121 0.12007175 0.51549119 -0.84844068 -19.30088 -91.51807 326.56688 20 generate ? -0.92222287 -0.37996506 0.07163448 -0.37996512 0.85624589 -0.34995644 0.07163447 -0.34995636 -0.93402303 -17.07423 59.59433 334.63978 21 generate ? -0.31194690 0.94904228 0.04480807 -0.39033496 -0.08501879 -0.91673908 -0.86621464 -0.30346407 0.39696570 -1.42642 151.03361 102.07748 22 generate ? -0.82509694 0.12148752 -0.55177515 0.12148751 -0.91561486 -0.38326257 -0.55177513 -0.38326258 0.74071181 95.69079 51.86622 41.75199 23 generate ? -0.44093458 -0.88214976 -0.16549435 0.79749356 -0.46966631 0.37870526 -0.41180184 0.03500354 0.91060089 20.72960 -76.96795 15.52864 24 generate ? 0.30964087 -0.67487696 0.66982354 0.70346581 0.63654112 0.31615078 -0.63973310 0.37330473 0.67185199 -122.71618 -57.42446 59.64721 25 generate ? 0.38935964 0.45686196 0.79979758 -0.03065259 0.87426635 -0.48447785 -0.92057564 0.16412024 0.35440799 -136.40935 83.48825 113.13734 26 generate ? -0.13669577 -0.53005044 0.83687560 0.91024646 -0.40053172 -0.10500386 0.39085261 0.74740938 0.53722750 -151.08204 8.03906 86.92565 27 generate ? -0.06970856 0.32660980 0.94258511 0.91546171 0.39633534 -0.06962924 -0.39632138 0.85804676 -0.32662678 -162.71943 8.14779 237.82179 28 generate ? -0.59867725 0.70856562 0.37352405 0.40726510 0.67082505 -0.61978138 -0.68972508 -0.21892566 -0.69018178 -60.89207 105.84798 292.51135 29 generate ? -0.99258510 0.08796708 -0.08388455 0.08796706 0.04360194 -0.99516870 -0.08388453 -0.99516860 -0.05101684 13.67809 166.12130 175.41521 30 generate ? -0.70706484 -0.67753974 0.20248245 0.39882663 -0.61853295 -0.67701871 0.58394920 -0.39794070 0.70756381 -42.06238 105.67206 48.35626 31 generate ? 0.92401757 -0.38234072 -0.00266410 -0.18128398 -0.44422949 0.87738040 -0.33664176 -0.81023185 -0.47978807 -2.60864 -164.55605 251.44976 32 generate ? 0.87595123 0.48182504 -0.02353786 -0.16898085 0.35217520 0.92055318 0.45183502 -0.80238218 0.38990755 7.79695 -165.80528 100.46880 33 generate ? 0.30964084 0.70346573 -0.63973311 -0.67487702 0.63654112 0.37330475 0.66982355 0.31615073 0.67185202 116.55238 -68.53189 60.27887 34 generate ? 0.00770809 -0.02371854 -0.99968894 -0.99984120 0.01588424 -0.00808616 0.01607107 0.99959242 -0.02359234 173.36135 -7.16439 186.42109 35 generate ? 0.38741379 -0.69478383 -0.60595864 -0.69478392 -0.65206873 0.30344972 -0.60595870 0.30344970 -0.73534506 99.71579 -66.51059 304.57120 36 generate ? -0.47537489 -0.03665113 -0.87901957 -0.33862752 0.92978001 0.14436254 0.81200379 0.36628654 -0.45440513 151.81310 -26.01262 257.23511 37 generate ? 0.01885427 -0.92992236 -0.36727210 -0.86796838 0.16710432 -0.46766137 0.49626149 0.32759799 -0.80399258 55.92770 74.29527 317.64541 38 generate ? 0.72997099 -0.52988159 0.43170341 -0.52988164 -0.83769986 -0.13222863 0.43170338 -0.13222861 -0.89227113 -79.69390 8.15585 329.36913 39 generate ? 0.67523613 0.61062843 0.41374996 0.20840833 -0.69602730 0.68710409 0.70754656 -0.37772855 -0.59724281 -67.62726 -133.02844 276.20448 40 generate ? -0.06970859 0.91546161 -0.39632139 0.32660988 0.39633532 0.85804684 0.94258514 -0.06962924 -0.32662673 75.45193 -154.14572 231.62320 41 generate ? -0.31194692 -0.39033487 -0.86621462 0.94904239 -0.08501881 -0.30346407 0.04480811 -0.91673899 0.39696573 146.92972 45.17128 98.00105 42 generate ? 0.34795925 -0.92402813 -0.15841797 0.81756928 0.38177542 -0.43107781 0.45880815 0.02047985 0.88829931 19.81720 70.99686 20.02329 43 generate ? 0.87595124 -0.16898086 0.45183502 0.48182508 0.35217524 -0.80238225 -0.02353786 0.92055309 0.38990750 -80.24299 135.25013 113.64255 44 generate ? 0.54236209 0.83135728 0.12119547 0.40579686 -0.13291292 -0.90424727 -0.73564415 0.53961012 -0.40944916 -14.97106 149.13525 249.48019 45 generate ? -0.19179936 0.69455298 -0.69340401 0.69455303 -0.40311370 -0.59589888 -0.69340401 -0.59589884 -0.40508694 125.42940 93.46346 239.81322 46 generate ? 0.92401756 -0.18128398 -0.33664173 -0.38234078 -0.44422945 -0.81023194 -0.00266414 0.87738032 -0.47978811 57.22753 129.63460 265.01389 47 generate ? 0.87279885 0.31270151 -0.37475312 0.31270154 -0.94778817 -0.06257259 -0.37475316 -0.06257259 -0.92501067 67.72233 -4.16456 334.96197 48 generate ? 0.54236207 0.40579685 -0.73564412 0.83135740 -0.13291296 0.53961018 0.12119547 -0.90424718 -0.40944911 131.12975 -102.35374 238.81900 49 generate ? 0.38935960 -0.03065255 -0.92057562 0.45686204 0.87426634 0.16412025 0.79979761 -0.48447779 0.35440803 159.82289 -29.23884 109.45130 50 generate ? 0.62523566 -0.39348845 -0.67397858 -0.29324469 0.68186216 -0.67012806 0.72324816 0.61662856 0.31093615 114.14881 114.13784 125.64063 51 generate ? -0.47537485 -0.33862750 0.81200378 -0.03665115 0.92978000 0.36628654 -0.87901959 0.14436256 -0.45440515 -145.51634 -64.47162 254.09090 52 generate ? -0.41337439 0.14797213 0.89845746 -0.74176266 0.51756044 -0.42652016 -0.52811916 -0.84275462 -0.10418605 -156.71306 69.98307 185.52226 53 generate ? -0.70706483 0.39882658 0.58394915 -0.67753983 -0.61853295 -0.39794072 0.20248247 -0.67701868 0.70756381 -100.12325 56.10564 45.84371 54 generate ? -0.95057598 0.06726355 0.30311863 0.06726357 -0.90845772 0.41252904 0.30311868 0.41252895 0.85903370 -53.95210 -86.92578 28.08625 55 generate ? -0.80738369 -0.38850814 0.44406414 0.46335457 0.04845231 0.88484747 -0.36528635 0.92017047 0.14089740 -82.00657 -161.44662 156.79009 56 generate ? -0.13669579 0.91024634 0.39085257 -0.53005046 -0.40053174 0.74740947 0.83687562 -0.10500389 0.53722753 -61.94492 -141.83026 80.58216 57 generate ? -0.80738371 0.46335450 -0.36528637 -0.38850816 0.04845231 0.92017056 0.44406416 0.88484737 0.14089741 65.86953 -168.31138 157.18048 58 generate ? -0.71124848 -0.63564258 -0.30014006 -0.63564265 0.39927067 0.66071280 -0.30014008 0.66071277 -0.68802220 45.93249 -120.49803 299.38274 59 generate ? 0.01885429 -0.86796828 0.49626152 -0.92992247 0.16710430 0.32759799 -0.36727215 -0.46766128 -0.80399258 -94.20373 -64.46663 310.67026 60 generate ? 0.37394739 0.08744361 0.92331845 -0.86466291 -0.32720078 0.38117948 0.33544220 -0.94090019 -0.04674661 -160.87564 -77.65068 175.44406 # _struct.entry_id 1C8F _struct.title 'FELINE PANLEUKOPENIA VIRUS EMPTY CAPSID STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1C8F _struct_keywords.pdbx_keywords VIRUS _struct_keywords.text 'beta barrel, viral capsid, icosahedral symmetry, Icosahedral virus, Virus' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 50 ? ALA A 55 ? ASN A 86 ALA A 91 1 ? 6 HELX_P HELX_P2 2 ASN A 59 ? ASP A 63 ? ASN A 95 ASP A 99 5 ? 5 HELX_P HELX_P3 3 ALA A 80 ? TRP A 84 ? ALA A 116 TRP A 120 5 ? 5 HELX_P HELX_P4 4 ASN A 86 ? THR A 96 ? ASN A 122 THR A 132 1 ? 11 HELX_P HELX_P5 5 PRO A 151 ? SER A 156 ? PRO A 187 SER A 192 5 ? 6 HELX_P HELX_P6 6 ASP A 201 ? VAL A 205 ? ASP A 237 VAL A 241 5 ? 5 HELX_P HELX_P7 7 THR A 209 ? VAL A 214 ? THR A 245 VAL A 250 1 ? 6 HELX_P HELX_P8 8 THR A 245 ? LEU A 249 ? THR A 281 LEU A 285 5 ? 5 HELX_P HELX_P9 9 TYR A 373 ? ASP A 377 ? TYR A 409 ASP A 413 5 ? 5 HELX_P HELX_P10 10 THR A 389 ? ASP A 391 ? THR A 425 ASP A 427 5 ? 3 HELX_P HELX_P11 11 ASN A 407 ? PHE A 412 ? ASN A 443 PHE A 448 1 ? 6 HELX_P HELX_P12 12 ASN A 521 ? TYR A 525 ? ASN A 557 TYR A 561 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 454 SG ? ? ? 1_555 A CYS 458 SG ? ? A CYS 490 A CYS 494 1_555 ? ? ? ? ? ? ? 2.024 ? ? metalc1 metalc ? ? A ASP 337 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 373 A CA 587 1_555 ? ? ? ? ? ? ? 3.151 ? ? metalc2 metalc ? ? A ASP 339 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 375 A CA 587 1_555 ? ? ? ? ? ? ? 3.270 ? ? metalc3 metalc ? ? A ASP 369 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 405 A CA 586 1_555 ? ? ? ? ? ? ? 2.725 ? ? metalc4 metalc ? ? A ASP 369 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 405 A CA 586 1_555 ? ? ? ? ? ? ? 3.346 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 124 A . ? PRO 160 A PRO 125 A ? PRO 161 A 1 -0.72 2 LEU 386 A . ? LEU 422 A PRO 387 A ? PRO 423 A 1 -0.53 3 TYR 428 A . ? TYR 464 A PRO 429 A ? PRO 465 A 1 0.81 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 10 ? B ? 7 ? C ? 2 ? D ? 2 ? E ? 2 ? F ? 2 ? G ? 2 ? H ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? parallel E 1 2 ? anti-parallel F 1 2 ? anti-parallel G 1 2 ? anti-parallel H 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 13 ? PHE A 17 ? THR A 49 PHE A 53 A 2 TRP A 22 ? ASN A 36 ? TRP A 58 ASN A 72 A 3 THR A 487 ? LEU A 503 ? THR A 523 LEU A 539 A 4 MET A 97 ? SER A 118 ? MET A 133 SER A 154 A 5 CYS A 237 ? ARG A 238 ? CYS A 273 ARG A 274 A 6 MET A 97 ? SER A 118 ? MET A 133 SER A 154 A 7 PHE A 230 ? PHE A 231 ? PHE A 266 PHE A 267 A 8 MET A 97 ? SER A 118 ? MET A 133 SER A 154 A 9 PHE A 225 ? ALA A 226 ? PHE A 261 ALA A 262 A 10 MET A 97 ? SER A 118 ? MET A 133 SER A 154 B 1 THR A 170 ? PHE A 176 ? THR A 206 PHE A 212 B 2 HIS A 66 ? LEU A 75 ? HIS A 102 LEU A 111 B 3 LYS A 44 ? VAL A 48 ? LYS A 80 VAL A 84 B 4 HIS A 66 ? LEU A 75 ? HIS A 102 LEU A 111 B 5 GLN A 461 ? VAL A 466 ? GLN A 497 VAL A 502 B 6 LEU A 137 ? ASP A 142 ? LEU A 173 ASP A 178 B 7 VAL A 216 ? LEU A 219 ? VAL A 252 LEU A 255 C 1 ASP A 179 ? LEU A 182 ? ASP A 215 LEU A 218 C 2 ASN A 195 ? GLY A 199 ? ASN A 231 GLY A 235 D 1 GLU A 299 ? VAL A 300 ? GLU A 335 VAL A 336 D 2 THR A 419 ? ALA A 420 ? THR A 455 ALA A 456 E 1 PHE A 309 ? SER A 312 ? PHE A 345 SER A 348 E 2 GLY A 315 ? LYS A 318 ? GLY A 351 LYS A 354 F 1 ARG A 341 ? PHE A 344 ? ARG A 377 PHE A 380 F 2 GLU A 360 ? THR A 363 ? GLU A 396 THR A 399 G 1 ILE A 379 ? GLN A 380 ? ILE A 415 GLN A 416 G 2 VAL A 393 ? LEU A 394 ? VAL A 429 LEU A 430 H 1 TRP A 434 ? LYS A 436 ? TRP A 470 LYS A 472 H 2 PHE A 452 ? CYS A 454 ? PHE A 488 CYS A 490 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 16 ? O LYS A 52 N GLU A 24 ? N GLU A 60 A 2 3 O LEU A 35 ? O LEU A 71 N SER A 489 ? N SER A 525 A 3 4 O LYS A 502 ? O LYS A 538 N SER A 98 ? N SER A 134 A 4 5 N LEU A 100 ? N LEU A 136 O CYS A 237 ? O CYS A 273 A 5 6 O CYS A 237 ? O CYS A 273 N LEU A 100 ? N LEU A 136 A 6 7 O PHE A 105 ? O PHE A 141 N PHE A 230 ? N PHE A 266 A 7 8 N PHE A 230 ? N PHE A 266 O PHE A 105 ? O PHE A 141 A 8 9 N ILE A 109 ? N ILE A 145 O PHE A 225 ? O PHE A 261 A 9 10 O PHE A 225 ? O PHE A 261 N ILE A 109 ? N ILE A 145 B 1 2 N PHE A 176 ? N PHE A 212 O VAL A 67 ? O VAL A 103 B 2 3 N VAL A 70 ? N VAL A 106 O LYS A 44 ? O LYS A 80 B 3 4 N VAL A 48 ? N VAL A 84 O HIS A 66 ? O HIS A 102 B 4 5 O SER A 74 ? O SER A 110 N VAL A 464 ? N VAL A 500 B 5 6 O LYS A 465 ? O LYS A 501 N MET A 138 ? N MET A 174 B 6 7 O VAL A 139 ? O VAL A 175 N HIS A 217 ? N HIS A 253 C 1 2 N THR A 181 ? N THR A 217 O VAL A 196 ? O VAL A 232 D 1 2 O GLU A 299 ? O GLU A 335 N ALA A 420 ? N ALA A 456 E 1 2 O SER A 312 ? O SER A 348 N GLY A 315 ? N GLY A 351 F 1 2 O PHE A 344 ? O PHE A 380 N GLU A 360 ? N GLU A 396 G 1 2 N ILE A 379 ? N ILE A 415 O LEU A 394 ? O LEU A 430 H 1 2 N ASP A 435 ? N ASP A 471 O PHE A 452 ? O PHE A 488 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 585 ? 1 'BINDING SITE FOR RESIDUE CA A 585' AC2 Software A CA 586 ? 1 'BINDING SITE FOR RESIDUE CA A 586' AC3 Software A CA 587 ? 3 'BINDING SITE FOR RESIDUE CA A 587' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 ARG A 325 ? ARG A 361 . ? 1_555 ? 2 AC2 1 ASP A 369 ? ASP A 405 . ? 1_555 ? 3 AC3 3 ARG A 325 ? ARG A 361 . ? 1_555 ? 4 AC3 3 ASP A 337 ? ASP A 373 . ? 1_555 ? 5 AC3 3 ASP A 339 ? ASP A 375 . ? 1_555 ? # _database_PDB_matrix.entry_id 1C8F _database_PDB_matrix.origx[1][1] 0.732844 _database_PDB_matrix.origx[1][2] 0.678523 _database_PDB_matrix.origx[1][3] 0.050460 _database_PDB_matrix.origx_vector[1] -2.853281 _database_PDB_matrix.origx[2][1] 0.537169 _database_PDB_matrix.origx[2][2] -0.622500 _database_PDB_matrix.origx[2][3] 0.569160 _database_PDB_matrix.origx_vector[2] -103.731937 _database_PDB_matrix.origx[3][1] 0.417599 _database_PDB_matrix.origx[3][2] -0.390000 _database_PDB_matrix.origx[3][3] -0.820677 _database_PDB_matrix.origx_vector[3] 140.418167 # _atom_sites.entry_id 1C8F _atom_sites.fract_transf_matrix[1][1] 0.002631 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.002637 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002850 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 37 37 GLY GLY A . n A 1 2 VAL 2 38 38 VAL VAL A . n A 1 3 GLY 3 39 39 GLY GLY A . n A 1 4 ILE 4 40 40 ILE ILE A . n A 1 5 SER 5 41 41 SER SER A . n A 1 6 THR 6 42 42 THR THR A . n A 1 7 GLY 7 43 43 GLY GLY A . n A 1 8 THR 8 44 44 THR THR A . n A 1 9 PHE 9 45 45 PHE PHE A . n A 1 10 ASN 10 46 46 ASN ASN A . n A 1 11 ASN 11 47 47 ASN ASN A . n A 1 12 GLN 12 48 48 GLN GLN A . n A 1 13 THR 13 49 49 THR THR A . n A 1 14 GLU 14 50 50 GLU GLU A . n A 1 15 PHE 15 51 51 PHE PHE A . n A 1 16 LYS 16 52 52 LYS LYS A . n A 1 17 PHE 17 53 53 PHE PHE A . n A 1 18 LEU 18 54 54 LEU LEU A . n A 1 19 GLU 19 55 55 GLU GLU A . n A 1 20 ASN 20 56 56 ASN ASN A . n A 1 21 GLY 21 57 57 GLY GLY A . n A 1 22 TRP 22 58 58 TRP TRP A . n A 1 23 VAL 23 59 59 VAL VAL A . n A 1 24 GLU 24 60 60 GLU GLU A . n A 1 25 ILE 25 61 61 ILE ILE A . n A 1 26 THR 26 62 62 THR THR A . n A 1 27 ALA 27 63 63 ALA ALA A . n A 1 28 ASN 28 64 64 ASN ASN A . n A 1 29 SER 29 65 65 SER SER A . n A 1 30 SER 30 66 66 SER SER A . n A 1 31 ARG 31 67 67 ARG ARG A . n A 1 32 LEU 32 68 68 LEU LEU A . n A 1 33 VAL 33 69 69 VAL VAL A . n A 1 34 HIS 34 70 70 HIS HIS A . n A 1 35 LEU 35 71 71 LEU LEU A . n A 1 36 ASN 36 72 72 ASN ASN A . n A 1 37 MET 37 73 73 MET MET A . n A 1 38 PRO 38 74 74 PRO PRO A . n A 1 39 GLU 39 75 75 GLU GLU A . n A 1 40 SER 40 76 76 SER SER A . n A 1 41 GLU 41 77 77 GLU GLU A . n A 1 42 ASN 42 78 78 ASN ASN A . n A 1 43 TYR 43 79 79 TYR TYR A . n A 1 44 LYS 44 80 80 LYS LYS A . n A 1 45 ARG 45 81 81 ARG ARG A . n A 1 46 VAL 46 82 82 VAL VAL A . n A 1 47 VAL 47 83 83 VAL VAL A . n A 1 48 VAL 48 84 84 VAL VAL A . n A 1 49 ASN 49 85 85 ASN ASN A . n A 1 50 ASN 50 86 86 ASN ASN A . n A 1 51 MET 51 87 87 MET MET A . n A 1 52 ASP 52 88 88 ASP ASP A . n A 1 53 LYS 53 89 89 LYS LYS A . n A 1 54 THR 54 90 90 THR THR A . n A 1 55 ALA 55 91 91 ALA ALA A . n A 1 56 VAL 56 92 92 VAL VAL A . n A 1 57 LYS 57 93 93 LYS LYS A . n A 1 58 GLY 58 94 94 GLY GLY A . n A 1 59 ASN 59 95 95 ASN ASN A . n A 1 60 MET 60 96 96 MET MET A . n A 1 61 ALA 61 97 97 ALA ALA A . n A 1 62 LEU 62 98 98 LEU LEU A . n A 1 63 ASP 63 99 99 ASP ASP A . n A 1 64 ASP 64 100 100 ASP ASP A . n A 1 65 ILE 65 101 101 ILE ILE A . n A 1 66 HIS 66 102 102 HIS HIS A . n A 1 67 VAL 67 103 103 VAL VAL A . n A 1 68 GLU 68 104 104 GLU GLU A . n A 1 69 ILE 69 105 105 ILE ILE A . n A 1 70 VAL 70 106 106 VAL VAL A . n A 1 71 THR 71 107 107 THR THR A . n A 1 72 PRO 72 108 108 PRO PRO A . n A 1 73 TRP 73 109 109 TRP TRP A . n A 1 74 SER 74 110 110 SER SER A . n A 1 75 LEU 75 111 111 LEU LEU A . n A 1 76 VAL 76 112 112 VAL VAL A . n A 1 77 ASP 77 113 113 ASP ASP A . n A 1 78 ALA 78 114 114 ALA ALA A . n A 1 79 ASN 79 115 115 ASN ASN A . n A 1 80 ALA 80 116 116 ALA ALA A . n A 1 81 TRP 81 117 117 TRP TRP A . n A 1 82 GLY 82 118 118 GLY GLY A . n A 1 83 VAL 83 119 119 VAL VAL A . n A 1 84 TRP 84 120 120 TRP TRP A . n A 1 85 PHE 85 121 121 PHE PHE A . n A 1 86 ASN 86 122 122 ASN ASN A . n A 1 87 PRO 87 123 123 PRO PRO A . n A 1 88 GLY 88 124 124 GLY GLY A . n A 1 89 ASP 89 125 125 ASP ASP A . n A 1 90 TRP 90 126 126 TRP TRP A . n A 1 91 GLN 91 127 127 GLN GLN A . n A 1 92 LEU 92 128 128 LEU LEU A . n A 1 93 ILE 93 129 129 ILE ILE A . n A 1 94 VAL 94 130 130 VAL VAL A . n A 1 95 ASN 95 131 131 ASN ASN A . n A 1 96 THR 96 132 132 THR THR A . n A 1 97 MET 97 133 133 MET MET A . n A 1 98 SER 98 134 134 SER SER A . n A 1 99 GLU 99 135 135 GLU GLU A . n A 1 100 LEU 100 136 136 LEU LEU A . n A 1 101 HIS 101 137 137 HIS HIS A . n A 1 102 LEU 102 138 138 LEU LEU A . n A 1 103 VAL 103 139 139 VAL VAL A . n A 1 104 SER 104 140 140 SER SER A . n A 1 105 PHE 105 141 141 PHE PHE A . n A 1 106 GLU 106 142 142 GLU GLU A . n A 1 107 GLN 107 143 143 GLN GLN A . n A 1 108 GLU 108 144 144 GLU GLU A . n A 1 109 ILE 109 145 145 ILE ILE A . n A 1 110 PHE 110 146 146 PHE PHE A . n A 1 111 ASN 111 147 147 ASN ASN A . n A 1 112 VAL 112 148 148 VAL VAL A . n A 1 113 VAL 113 149 149 VAL VAL A . n A 1 114 LEU 114 150 150 LEU LEU A . n A 1 115 LYS 115 151 151 LYS LYS A . n A 1 116 THR 116 152 152 THR THR A . n A 1 117 VAL 117 153 153 VAL VAL A . n A 1 118 SER 118 154 154 SER SER A . n A 1 119 GLU 119 155 155 GLU GLU A . n A 1 120 SER 120 156 156 SER SER A . n A 1 121 ALA 121 157 157 ALA ALA A . n A 1 122 THR 122 158 158 THR THR A . n A 1 123 GLN 123 159 159 GLN GLN A . n A 1 124 PRO 124 160 160 PRO PRO A . n A 1 125 PRO 125 161 161 PRO PRO A . n A 1 126 THR 126 162 162 THR THR A . n A 1 127 LYS 127 163 163 LYS LYS A . n A 1 128 VAL 128 164 164 VAL VAL A . n A 1 129 TYR 129 165 165 TYR TYR A . n A 1 130 ASN 130 166 166 ASN ASN A . n A 1 131 ASN 131 167 167 ASN ASN A . n A 1 132 ASP 132 168 168 ASP ASP A . n A 1 133 LEU 133 169 169 LEU LEU A . n A 1 134 THR 134 170 170 THR THR A . n A 1 135 ALA 135 171 171 ALA ALA A . n A 1 136 SER 136 172 172 SER SER A . n A 1 137 LEU 137 173 173 LEU LEU A . n A 1 138 MET 138 174 174 MET MET A . n A 1 139 VAL 139 175 175 VAL VAL A . n A 1 140 ALA 140 176 176 ALA ALA A . n A 1 141 LEU 141 177 177 LEU LEU A . n A 1 142 ASP 142 178 178 ASP ASP A . n A 1 143 SER 143 179 179 SER SER A . n A 1 144 ASN 144 180 180 ASN ASN A . n A 1 145 ASN 145 181 181 ASN ASN A . n A 1 146 THR 146 182 182 THR THR A . n A 1 147 MET 147 183 183 MET MET A . n A 1 148 PRO 148 184 184 PRO PRO A . n A 1 149 PHE 149 185 185 PHE PHE A . n A 1 150 THR 150 186 186 THR THR A . n A 1 151 PRO 151 187 187 PRO PRO A . n A 1 152 ALA 152 188 188 ALA ALA A . n A 1 153 ALA 153 189 189 ALA ALA A . n A 1 154 MET 154 190 190 MET MET A . n A 1 155 ARG 155 191 191 ARG ARG A . n A 1 156 SER 156 192 192 SER SER A . n A 1 157 GLU 157 193 193 GLU GLU A . n A 1 158 THR 158 194 194 THR THR A . n A 1 159 LEU 159 195 195 LEU LEU A . n A 1 160 GLY 160 196 196 GLY GLY A . n A 1 161 PHE 161 197 197 PHE PHE A . n A 1 162 TYR 162 198 198 TYR TYR A . n A 1 163 PRO 163 199 199 PRO PRO A . n A 1 164 TRP 164 200 200 TRP TRP A . n A 1 165 LYS 165 201 201 LYS LYS A . n A 1 166 PRO 166 202 202 PRO PRO A . n A 1 167 THR 167 203 203 THR THR A . n A 1 168 ILE 168 204 204 ILE ILE A . n A 1 169 PRO 169 205 205 PRO PRO A . n A 1 170 THR 170 206 206 THR THR A . n A 1 171 PRO 171 207 207 PRO PRO A . n A 1 172 TRP 172 208 208 TRP TRP A . n A 1 173 ARG 173 209 209 ARG ARG A . n A 1 174 TYR 174 210 210 TYR TYR A . n A 1 175 TYR 175 211 211 TYR TYR A . n A 1 176 PHE 176 212 212 PHE PHE A . n A 1 177 GLN 177 213 213 GLN GLN A . n A 1 178 TRP 178 214 214 TRP TRP A . n A 1 179 ASP 179 215 215 ASP ASP A . n A 1 180 ARG 180 216 216 ARG ARG A . n A 1 181 THR 181 217 217 THR THR A . n A 1 182 LEU 182 218 218 LEU LEU A . n A 1 183 ILE 183 219 219 ILE ILE A . n A 1 184 PRO 184 220 220 PRO PRO A . n A 1 185 SER 185 221 221 SER SER A . n A 1 186 HIS 186 222 222 HIS HIS A . n A 1 187 THR 187 223 223 THR THR A . n A 1 188 GLY 188 224 224 GLY GLY A . n A 1 189 THR 189 225 225 THR THR A . n A 1 190 SER 190 226 226 SER SER A . n A 1 191 GLY 191 227 227 GLY GLY A . n A 1 192 THR 192 228 228 THR THR A . n A 1 193 PRO 193 229 229 PRO PRO A . n A 1 194 THR 194 230 230 THR THR A . n A 1 195 ASN 195 231 231 ASN ASN A . n A 1 196 VAL 196 232 232 VAL VAL A . n A 1 197 TYR 197 233 233 TYR TYR A . n A 1 198 HIS 198 234 234 HIS HIS A . n A 1 199 GLY 199 235 235 GLY GLY A . n A 1 200 THR 200 236 236 THR THR A . n A 1 201 ASP 201 237 237 ASP ASP A . n A 1 202 PRO 202 238 238 PRO PRO A . n A 1 203 ASP 203 239 239 ASP ASP A . n A 1 204 ASP 204 240 240 ASP ASP A . n A 1 205 VAL 205 241 241 VAL VAL A . n A 1 206 GLN 206 242 242 GLN GLN A . n A 1 207 PHE 207 243 243 PHE PHE A . n A 1 208 TYR 208 244 244 TYR TYR A . n A 1 209 THR 209 245 245 THR THR A . n A 1 210 ILE 210 246 246 ILE ILE A . n A 1 211 GLU 211 247 247 GLU GLU A . n A 1 212 ASN 212 248 248 ASN ASN A . n A 1 213 SER 213 249 249 SER SER A . n A 1 214 VAL 214 250 250 VAL VAL A . n A 1 215 PRO 215 251 251 PRO PRO A . n A 1 216 VAL 216 252 252 VAL VAL A . n A 1 217 HIS 217 253 253 HIS HIS A . n A 1 218 LEU 218 254 254 LEU LEU A . n A 1 219 LEU 219 255 255 LEU LEU A . n A 1 220 ARG 220 256 256 ARG ARG A . n A 1 221 THR 221 257 257 THR THR A . n A 1 222 GLY 222 258 258 GLY GLY A . n A 1 223 ASP 223 259 259 ASP ASP A . n A 1 224 GLU 224 260 260 GLU GLU A . n A 1 225 PHE 225 261 261 PHE PHE A . n A 1 226 ALA 226 262 262 ALA ALA A . n A 1 227 THR 227 263 263 THR THR A . n A 1 228 GLY 228 264 264 GLY GLY A . n A 1 229 THR 229 265 265 THR THR A . n A 1 230 PHE 230 266 266 PHE PHE A . n A 1 231 PHE 231 267 267 PHE PHE A . n A 1 232 PHE 232 268 268 PHE PHE A . n A 1 233 ASP 233 269 269 ASP ASP A . n A 1 234 CYS 234 270 270 CYS CYS A . n A 1 235 LYS 235 271 271 LYS LYS A . n A 1 236 PRO 236 272 272 PRO PRO A . n A 1 237 CYS 237 273 273 CYS CYS A . n A 1 238 ARG 238 274 274 ARG ARG A . n A 1 239 LEU 239 275 275 LEU LEU A . n A 1 240 THR 240 276 276 THR THR A . n A 1 241 HIS 241 277 277 HIS HIS A . n A 1 242 THR 242 278 278 THR THR A . n A 1 243 TRP 243 279 279 TRP TRP A . n A 1 244 GLN 244 280 280 GLN GLN A . n A 1 245 THR 245 281 281 THR THR A . n A 1 246 ASN 246 282 282 ASN ASN A . n A 1 247 ARG 247 283 283 ARG ARG A . n A 1 248 ALA 248 284 284 ALA ALA A . n A 1 249 LEU 249 285 285 LEU LEU A . n A 1 250 GLY 250 286 286 GLY GLY A . n A 1 251 LEU 251 287 287 LEU LEU A . n A 1 252 PRO 252 288 288 PRO PRO A . n A 1 253 PRO 253 289 289 PRO PRO A . n A 1 254 PHE 254 290 290 PHE PHE A . n A 1 255 LEU 255 291 291 LEU LEU A . n A 1 256 ASN 256 292 292 ASN ASN A . n A 1 257 SER 257 293 293 SER SER A . n A 1 258 LEU 258 294 294 LEU LEU A . n A 1 259 PRO 259 295 295 PRO PRO A . n A 1 260 GLN 260 296 296 GLN GLN A . n A 1 261 SER 261 297 297 SER SER A . n A 1 262 GLU 262 298 298 GLU GLU A . n A 1 263 GLY 263 299 299 GLY GLY A . n A 1 264 ALA 264 300 300 ALA ALA A . n A 1 265 THR 265 301 301 THR THR A . n A 1 266 ASN 266 302 302 ASN ASN A . n A 1 267 PHE 267 303 303 PHE PHE A . n A 1 268 GLY 268 304 304 GLY GLY A . n A 1 269 ASP 269 305 305 ASP ASP A . n A 1 270 ILE 270 306 306 ILE ILE A . n A 1 271 GLY 271 307 307 GLY GLY A . n A 1 272 VAL 272 308 308 VAL VAL A . n A 1 273 GLN 273 309 309 GLN GLN A . n A 1 274 GLN 274 310 310 GLN GLN A . n A 1 275 ASP 275 311 311 ASP ASP A . n A 1 276 LYS 276 312 312 LYS LYS A . n A 1 277 ARG 277 313 313 ARG ARG A . n A 1 278 ARG 278 314 314 ARG ARG A . n A 1 279 GLY 279 315 315 GLY GLY A . n A 1 280 VAL 280 316 316 VAL VAL A . n A 1 281 THR 281 317 317 THR THR A . n A 1 282 GLN 282 318 318 GLN GLN A . n A 1 283 MET 283 319 319 MET MET A . n A 1 284 GLY 284 320 320 GLY GLY A . n A 1 285 ASN 285 321 321 ASN ASN A . n A 1 286 THR 286 322 322 THR THR A . n A 1 287 ASP 287 323 323 ASP ASP A . n A 1 288 TYR 288 324 324 TYR TYR A . n A 1 289 ILE 289 325 325 ILE ILE A . n A 1 290 THR 290 326 326 THR THR A . n A 1 291 GLU 291 327 327 GLU GLU A . n A 1 292 ALA 292 328 328 ALA ALA A . n A 1 293 THR 293 329 329 THR THR A . n A 1 294 ILE 294 330 330 ILE ILE A . n A 1 295 MET 295 331 331 MET MET A . n A 1 296 ARG 296 332 332 ARG ARG A . n A 1 297 PRO 297 333 333 PRO PRO A . n A 1 298 ALA 298 334 334 ALA ALA A . n A 1 299 GLU 299 335 335 GLU GLU A . n A 1 300 VAL 300 336 336 VAL VAL A . n A 1 301 GLY 301 337 337 GLY GLY A . n A 1 302 TYR 302 338 338 TYR TYR A . n A 1 303 SER 303 339 339 SER SER A . n A 1 304 ALA 304 340 340 ALA ALA A . n A 1 305 PRO 305 341 341 PRO PRO A . n A 1 306 TYR 306 342 342 TYR TYR A . n A 1 307 TYR 307 343 343 TYR TYR A . n A 1 308 SER 308 344 344 SER SER A . n A 1 309 PHE 309 345 345 PHE PHE A . n A 1 310 GLU 310 346 346 GLU GLU A . n A 1 311 ALA 311 347 347 ALA ALA A . n A 1 312 SER 312 348 348 SER SER A . n A 1 313 THR 313 349 349 THR THR A . n A 1 314 GLN 314 350 350 GLN GLN A . n A 1 315 GLY 315 351 351 GLY GLY A . n A 1 316 PRO 316 352 352 PRO PRO A . n A 1 317 PHE 317 353 353 PHE PHE A . n A 1 318 LYS 318 354 354 LYS LYS A . n A 1 319 THR 319 355 355 THR THR A . n A 1 320 PRO 320 356 356 PRO PRO A . n A 1 321 ILE 321 357 357 ILE ILE A . n A 1 322 ALA 322 358 358 ALA ALA A . n A 1 323 ALA 323 359 359 ALA ALA A . n A 1 324 GLY 324 360 360 GLY GLY A . n A 1 325 ARG 325 361 361 ARG ARG A . n A 1 326 GLY 326 362 362 GLY GLY A . n A 1 327 GLY 327 363 363 GLY GLY A . n A 1 328 ALA 328 364 364 ALA ALA A . n A 1 329 GLN 329 365 365 GLN GLN A . n A 1 330 THR 330 366 366 THR THR A . n A 1 331 ASP 331 367 367 ASP ASP A . n A 1 332 GLU 332 368 368 GLU GLU A . n A 1 333 ASN 333 369 369 ASN ASN A . n A 1 334 GLN 334 370 370 GLN GLN A . n A 1 335 ALA 335 371 371 ALA ALA A . n A 1 336 ALA 336 372 372 ALA ALA A . n A 1 337 ASP 337 373 373 ASP ASP A . n A 1 338 GLY 338 374 374 GLY GLY A . n A 1 339 ASP 339 375 375 ASP ASP A . n A 1 340 PRO 340 376 376 PRO PRO A . n A 1 341 ARG 341 377 377 ARG ARG A . n A 1 342 TYR 342 378 378 TYR TYR A . n A 1 343 ALA 343 379 379 ALA ALA A . n A 1 344 PHE 344 380 380 PHE PHE A . n A 1 345 GLY 345 381 381 GLY GLY A . n A 1 346 ARG 346 382 382 ARG ARG A . n A 1 347 GLN 347 383 383 GLN GLN A . n A 1 348 HIS 348 384 384 HIS HIS A . n A 1 349 GLY 349 385 385 GLY GLY A . n A 1 350 GLN 350 386 386 GLN GLN A . n A 1 351 LYS 351 387 387 LYS LYS A . n A 1 352 THR 352 388 388 THR THR A . n A 1 353 THR 353 389 389 THR THR A . n A 1 354 THR 354 390 390 THR THR A . n A 1 355 THR 355 391 391 THR THR A . n A 1 356 GLY 356 392 392 GLY GLY A . n A 1 357 GLU 357 393 393 GLU GLU A . n A 1 358 THR 358 394 394 THR THR A . n A 1 359 PRO 359 395 395 PRO PRO A . n A 1 360 GLU 360 396 396 GLU GLU A . n A 1 361 ARG 361 397 397 ARG ARG A . n A 1 362 PHE 362 398 398 PHE PHE A . n A 1 363 THR 363 399 399 THR THR A . n A 1 364 TYR 364 400 400 TYR TYR A . n A 1 365 ILE 365 401 401 ILE ILE A . n A 1 366 ALA 366 402 402 ALA ALA A . n A 1 367 HIS 367 403 403 HIS HIS A . n A 1 368 GLN 368 404 404 GLN GLN A . n A 1 369 ASP 369 405 405 ASP ASP A . n A 1 370 THR 370 406 406 THR THR A . n A 1 371 GLY 371 407 407 GLY GLY A . n A 1 372 ARG 372 408 408 ARG ARG A . n A 1 373 TYR 373 409 409 TYR TYR A . n A 1 374 PRO 374 410 410 PRO PRO A . n A 1 375 GLU 375 411 411 GLU GLU A . n A 1 376 GLY 376 412 412 GLY GLY A . n A 1 377 ASP 377 413 413 ASP ASP A . n A 1 378 TRP 378 414 414 TRP TRP A . n A 1 379 ILE 379 415 415 ILE ILE A . n A 1 380 GLN 380 416 416 GLN GLN A . n A 1 381 ASN 381 417 417 ASN ASN A . n A 1 382 ILE 382 418 418 ILE ILE A . n A 1 383 ASN 383 419 419 ASN ASN A . n A 1 384 PHE 384 420 420 PHE PHE A . n A 1 385 ASN 385 421 421 ASN ASN A . n A 1 386 LEU 386 422 422 LEU LEU A . n A 1 387 PRO 387 423 423 PRO PRO A . n A 1 388 VAL 388 424 424 VAL VAL A . n A 1 389 THR 389 425 425 THR THR A . n A 1 390 ASN 390 426 426 ASN ASN A . n A 1 391 ASP 391 427 427 ASP ASP A . n A 1 392 ASN 392 428 428 ASN ASN A . n A 1 393 VAL 393 429 429 VAL VAL A . n A 1 394 LEU 394 430 430 LEU LEU A . n A 1 395 LEU 395 431 431 LEU LEU A . n A 1 396 PRO 396 432 432 PRO PRO A . n A 1 397 THR 397 433 433 THR THR A . n A 1 398 ASP 398 434 434 ASP ASP A . n A 1 399 PRO 399 435 435 PRO PRO A . n A 1 400 ILE 400 436 436 ILE ILE A . n A 1 401 GLY 401 437 437 GLY GLY A . n A 1 402 GLY 402 438 438 GLY GLY A . n A 1 403 LYS 403 439 439 LYS LYS A . n A 1 404 THR 404 440 440 THR THR A . n A 1 405 GLY 405 441 441 GLY GLY A . n A 1 406 ILE 406 442 442 ILE ILE A . n A 1 407 ASN 407 443 443 ASN ASN A . n A 1 408 TYR 408 444 444 TYR TYR A . n A 1 409 THR 409 445 445 THR THR A . n A 1 410 ASN 410 446 446 ASN ASN A . n A 1 411 ILE 411 447 447 ILE ILE A . n A 1 412 PHE 412 448 448 PHE PHE A . n A 1 413 ASN 413 449 449 ASN ASN A . n A 1 414 THR 414 450 450 THR THR A . n A 1 415 TYR 415 451 451 TYR TYR A . n A 1 416 GLY 416 452 452 GLY GLY A . n A 1 417 PRO 417 453 453 PRO PRO A . n A 1 418 LEU 418 454 454 LEU LEU A . n A 1 419 THR 419 455 455 THR THR A . n A 1 420 ALA 420 456 456 ALA ALA A . n A 1 421 LEU 421 457 457 LEU LEU A . n A 1 422 ASN 422 458 458 ASN ASN A . n A 1 423 ASN 423 459 459 ASN ASN A . n A 1 424 VAL 424 460 460 VAL VAL A . n A 1 425 PRO 425 461 461 PRO PRO A . n A 1 426 PRO 426 462 462 PRO PRO A . n A 1 427 VAL 427 463 463 VAL VAL A . n A 1 428 TYR 428 464 464 TYR TYR A . n A 1 429 PRO 429 465 465 PRO PRO A . n A 1 430 ASN 430 466 466 ASN ASN A . n A 1 431 GLY 431 467 467 GLY GLY A . n A 1 432 GLN 432 468 468 GLN GLN A . n A 1 433 ILE 433 469 469 ILE ILE A . n A 1 434 TRP 434 470 470 TRP TRP A . n A 1 435 ASP 435 471 471 ASP ASP A . n A 1 436 LYS 436 472 472 LYS LYS A . n A 1 437 GLU 437 473 473 GLU GLU A . n A 1 438 PHE 438 474 474 PHE PHE A . n A 1 439 ASP 439 475 475 ASP ASP A . n A 1 440 THR 440 476 476 THR THR A . n A 1 441 ASP 441 477 477 ASP ASP A . n A 1 442 LEU 442 478 478 LEU LEU A . n A 1 443 LYS 443 479 479 LYS LYS A . n A 1 444 PRO 444 480 480 PRO PRO A . n A 1 445 ARG 445 481 481 ARG ARG A . n A 1 446 LEU 446 482 482 LEU LEU A . n A 1 447 HIS 447 483 483 HIS HIS A . n A 1 448 ILE 448 484 484 ILE ILE A . n A 1 449 ASN 449 485 485 ASN ASN A . n A 1 450 ALA 450 486 486 ALA ALA A . n A 1 451 PRO 451 487 487 PRO PRO A . n A 1 452 PHE 452 488 488 PHE PHE A . n A 1 453 VAL 453 489 489 VAL VAL A . n A 1 454 CYS 454 490 490 CYS CYS A . n A 1 455 GLN 455 491 491 GLN GLN A . n A 1 456 ASN 456 492 492 ASN ASN A . n A 1 457 ASN 457 493 493 ASN ASN A . n A 1 458 CYS 458 494 494 CYS CYS A . n A 1 459 PRO 459 495 495 PRO PRO A . n A 1 460 GLY 460 496 496 GLY GLY A . n A 1 461 GLN 461 497 497 GLN GLN A . n A 1 462 LEU 462 498 498 LEU LEU A . n A 1 463 PHE 463 499 499 PHE PHE A . n A 1 464 VAL 464 500 500 VAL VAL A . n A 1 465 LYS 465 501 501 LYS LYS A . n A 1 466 VAL 466 502 502 VAL VAL A . n A 1 467 ALA 467 503 503 ALA ALA A . n A 1 468 PRO 468 504 504 PRO PRO A . n A 1 469 ASN 469 505 505 ASN ASN A . n A 1 470 LEU 470 506 506 LEU LEU A . n A 1 471 THR 471 507 507 THR THR A . n A 1 472 ASN 472 508 508 ASN ASN A . n A 1 473 GLN 473 509 509 GLN GLN A . n A 1 474 TYR 474 510 510 TYR TYR A . n A 1 475 ASP 475 511 511 ASP ASP A . n A 1 476 PRO 476 512 512 PRO PRO A . n A 1 477 ASP 477 513 513 ASP ASP A . n A 1 478 ALA 478 514 514 ALA ALA A . n A 1 479 SER 479 515 515 SER SER A . n A 1 480 ALA 480 516 516 ALA ALA A . n A 1 481 ASN 481 517 517 ASN ASN A . n A 1 482 MET 482 518 518 MET MET A . n A 1 483 SER 483 519 519 SER SER A . n A 1 484 ARG 484 520 520 ARG ARG A . n A 1 485 ILE 485 521 521 ILE ILE A . n A 1 486 VAL 486 522 522 VAL VAL A . n A 1 487 THR 487 523 523 THR THR A . n A 1 488 TYR 488 524 524 TYR TYR A . n A 1 489 SER 489 525 525 SER SER A . n A 1 490 ASP 490 526 526 ASP ASP A . n A 1 491 PHE 491 527 527 PHE PHE A . n A 1 492 TRP 492 528 528 TRP TRP A . n A 1 493 TRP 493 529 529 TRP TRP A . n A 1 494 LYS 494 530 530 LYS LYS A . n A 1 495 GLY 495 531 531 GLY GLY A . n A 1 496 LYS 496 532 532 LYS LYS A . n A 1 497 LEU 497 533 533 LEU LEU A . n A 1 498 VAL 498 534 534 VAL VAL A . n A 1 499 PHE 499 535 535 PHE PHE A . n A 1 500 LYS 500 536 536 LYS LYS A . n A 1 501 ALA 501 537 537 ALA ALA A . n A 1 502 LYS 502 538 538 LYS LYS A . n A 1 503 LEU 503 539 539 LEU LEU A . n A 1 504 ARG 504 540 540 ARG ARG A . n A 1 505 ALA 505 541 541 ALA ALA A . n A 1 506 SER 506 542 542 SER SER A . n A 1 507 HIS 507 543 543 HIS HIS A . n A 1 508 THR 508 544 544 THR THR A . n A 1 509 TRP 509 545 545 TRP TRP A . n A 1 510 ASN 510 546 546 ASN ASN A . n A 1 511 PRO 511 547 547 PRO PRO A . n A 1 512 ILE 512 548 548 ILE ILE A . n A 1 513 GLN 513 549 549 GLN GLN A . n A 1 514 GLN 514 550 550 GLN GLN A . n A 1 515 MET 515 551 551 MET MET A . n A 1 516 SER 516 552 552 SER SER A . n A 1 517 ILE 517 553 553 ILE ILE A . n A 1 518 ASN 518 554 554 ASN ASN A . n A 1 519 VAL 519 555 555 VAL VAL A . n A 1 520 ASP 520 556 556 ASP ASP A . n A 1 521 ASN 521 557 557 ASN ASN A . n A 1 522 GLN 522 558 558 GLN GLN A . n A 1 523 PHE 523 559 559 PHE PHE A . n A 1 524 ASN 524 560 560 ASN ASN A . n A 1 525 TYR 525 561 561 TYR TYR A . n A 1 526 VAL 526 562 562 VAL VAL A . n A 1 527 PRO 527 563 563 PRO PRO A . n A 1 528 ASN 528 564 564 ASN ASN A . n A 1 529 ASN 529 565 565 ASN ASN A . n A 1 530 ILE 530 566 566 ILE ILE A . n A 1 531 GLY 531 567 567 GLY GLY A . n A 1 532 ALA 532 568 568 ALA ALA A . n A 1 533 MET 533 569 569 MET MET A . n A 1 534 LYS 534 570 570 LYS LYS A . n A 1 535 ILE 535 571 571 ILE ILE A . n A 1 536 VAL 536 572 572 VAL VAL A . n A 1 537 TYR 537 573 573 TYR TYR A . n A 1 538 GLU 538 574 574 GLU GLU A . n A 1 539 LYS 539 575 575 LYS LYS A . n A 1 540 SER 540 576 576 SER SER A . n A 1 541 GLN 541 577 577 GLN GLN A . n A 1 542 LEU 542 578 578 LEU LEU A . n A 1 543 ALA 543 579 579 ALA ALA A . n A 1 544 PRO 544 580 580 PRO PRO A . n A 1 545 ARG 545 581 581 ARG ARG A . n A 1 546 LYS 546 582 582 LYS LYS A . n A 1 547 LEU 547 583 583 LEU LEU A . n A 1 548 TYR 548 584 584 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 585 585 CA CA A . C 2 CA 1 586 586 CA CA A . D 2 CA 1 587 587 CA CA A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'complete icosahedral assembly' ? 'complete icosahedral assembly' 60 2 'icosahedral asymmetric unit' ? monomeric 1 3 'icosahedral pentamer' ? pentameric 5 4 'icosahedral 23 hexamer' ? hexameric 6 5 'icosahedral asymmetric unit, std point frame' ? monomeric 1 6 'crystal asymmetric unit, crystal frame' ? 60-meric 60 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-60)' A,B,C,D 2 1 A,B,C,D 3 '(1-5)' A,B,C,D 4 '(1,2,6,10,23,24)' A,B,C,D 5 P A,B,C,D 6 '(X0)(1-60)' A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] X0 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 P 'transform to point frame' ? ? -0.53716867 0.62250016 -0.56916027 103.73194 0.73284416 0.67852285 0.05045980 -2.85328 0.41759948 -0.39000030 -0.82067682 140.41817 1 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 2 'point symmetry operation' ? ? 0.68792132 0.65148640 -0.31989009 60.66790 -0.62593677 0.30944772 -0.71585290 118.90606 -0.36737919 0.69268137 0.62066495 71.31510 3 'point symmetry operation' ? ? 0.18296741 0.42819046 -0.88497222 157.05533 -0.36130050 -0.80788937 -0.46559288 66.67589 -0.91432211 0.40492916 0.00688798 175.65377 4 'point symmetry operation' ? ? 0.18296741 -0.36130042 -0.91432208 155.95814 0.42819050 -0.80788939 0.40492923 -84.51020 -0.88497223 -0.46559284 0.00688800 168.82352 5 'point symmetry operation' ? ? 0.68792132 -0.62593667 -0.36737917 58.89261 0.65148649 0.30944768 0.69268145 -125.71817 -0.31989008 -0.71585283 0.62066498 60.26352 6 'point symmetry operation' ? ? -0.65122136 -0.32572784 -0.68542841 115.62510 -0.32572788 -0.69579950 0.64012848 -125.27427 -0.68542841 0.64012840 0.34702085 118.36814 7 'point symmetry operation' ? ? 0.00770812 -0.99984108 0.01607110 -11.49553 -0.02371855 0.01588422 0.99959252 -182.11945 -0.99968897 -0.00808614 -0.02359234 177.64761 8 'point symmetry operation' ? ? 0.62523569 -0.29324466 0.72324816 -128.76895 -0.39348850 0.68186213 0.61662861 -110.38363 -0.67397861 -0.67012798 0.31093615 114.35460 9 'point symmetry operation' ? ? 0.34795926 0.81756918 0.45880811 -74.12727 -0.92402825 0.38177542 0.02047984 -9.20328 -0.15841798 -0.43107779 0.88829931 15.95790 10 'point symmetry operation' ? ? -0.44093459 0.79749347 -0.41180188 76.91656 -0.88214988 -0.46966630 0.03500356 -18.40620 -0.16549434 0.37870518 0.91060089 18.43840 11 'point symmetry operation' ? ? 0.07412105 0.99450294 0.07395834 -5.83402 0.99450307 -0.07921343 0.06847626 -19.62003 0.07395834 0.06847626 -0.99490762 348.55605 12 'point symmetry operation' ? ? -0.59867727 0.40726508 -0.68972506 122.18952 0.70856571 0.67082504 -0.21892570 36.17881 0.37352407 -0.61978129 -0.69018175 290.23325 13 'point symmetry operation' ? ? -0.41337442 -0.74176255 -0.52811913 85.10751 0.14797215 0.51756045 -0.84275472 143.31846 0.89845749 -0.42652009 -0.10418603 189.97804 14 'point symmetry operation' ? ? 0.37394737 -0.86466282 0.33544222 -65.83398 0.08744363 -0.32720075 -0.94090028 153.73556 0.92331846 0.38117945 -0.04674663 186.33971 15 'point symmetry operation' ? ? 0.67523614 0.20840827 0.70754657 -122.03894 0.61062851 -0.69602728 -0.37772857 53.03403 0.41374995 0.68710401 -0.59724284 284.34630 16 'point symmetry operation' ? ? -0.42289969 -0.66877511 0.61147007 -113.09508 -0.66877519 -0.22498707 -0.70860474 113.39830 0.61147007 -0.70860465 -0.35211323 230.76382 17 'point symmetry operation' ? ? -0.09695216 -0.05891041 0.99354406 -174.66589 -0.05891039 -0.99615697 -0.06481391 -4.46143 0.99354409 -0.06481393 0.09310914 158.49204 18 'point symmetry operation' ? ? -0.39482869 0.60681675 0.68984320 -116.69788 0.60681685 -0.39153321 0.69171899 -131.10671 0.68984323 0.69171890 -0.21363810 217.70159 19 'point symmetry operation' ? ? -0.90487404 0.40839406 0.12007174 -19.30088 0.40839413 0.75331472 0.51549121 -91.51807 0.12007175 0.51549119 -0.84844068 326.56688 20 'point symmetry operation' ? ? -0.92222287 -0.37996506 0.07163448 -17.07423 -0.37996512 0.85624589 -0.34995644 59.59433 0.07163447 -0.34995636 -0.93402303 334.63978 21 'point symmetry operation' ? ? -0.31194690 0.94904228 0.04480807 -1.42642 -0.39033496 -0.08501879 -0.91673908 151.03361 -0.86621464 -0.30346407 0.39696570 102.07748 22 'point symmetry operation' ? ? -0.82509694 0.12148752 -0.55177515 95.69079 0.12148751 -0.91561486 -0.38326257 51.86622 -0.55177513 -0.38326258 0.74071181 41.75199 23 'point symmetry operation' ? ? -0.44093458 -0.88214976 -0.16549435 20.72960 0.79749356 -0.46966631 0.37870526 -76.96795 -0.41180184 0.03500354 0.91060089 15.52864 24 'point symmetry operation' ? ? 0.30964087 -0.67487696 0.66982354 -122.71618 0.70346581 0.63654112 0.31615078 -57.42446 -0.63973310 0.37330473 0.67185199 59.64721 25 'point symmetry operation' ? ? 0.38935964 0.45686196 0.79979758 -136.40935 -0.03065259 0.87426635 -0.48447785 83.48825 -0.92057564 0.16412024 0.35440799 113.13734 26 'point symmetry operation' ? ? -0.13669577 -0.53005044 0.83687560 -151.08204 0.91024646 -0.40053172 -0.10500386 8.03906 0.39085261 0.74740938 0.53722750 86.92565 27 'point symmetry operation' ? ? -0.06970856 0.32660980 0.94258511 -162.71943 0.91546171 0.39633534 -0.06962924 8.14779 -0.39632138 0.85804676 -0.32662678 237.82179 28 'point symmetry operation' ? ? -0.59867725 0.70856562 0.37352405 -60.89207 0.40726510 0.67082505 -0.61978138 105.84798 -0.68972508 -0.21892566 -0.69018178 292.51135 29 'point symmetry operation' ? ? -0.99258510 0.08796708 -0.08388455 13.67809 0.08796706 0.04360194 -0.99516870 166.12130 -0.08388453 -0.99516860 -0.05101684 175.41521 30 'point symmetry operation' ? ? -0.70706484 -0.67753974 0.20248245 -42.06238 0.39882663 -0.61853295 -0.67701871 105.67206 0.58394920 -0.39794070 0.70756381 48.35626 31 'point symmetry operation' ? ? 0.92401757 -0.38234072 -0.00266410 -2.60864 -0.18128398 -0.44422949 0.87738040 -164.55605 -0.33664176 -0.81023185 -0.47978807 251.44976 32 'point symmetry operation' ? ? 0.87595123 0.48182504 -0.02353786 7.79695 -0.16898085 0.35217520 0.92055318 -165.80528 0.45183502 -0.80238218 0.38990755 100.46880 33 'point symmetry operation' ? ? 0.30964084 0.70346573 -0.63973311 116.55238 -0.67487702 0.63654112 0.37330475 -68.53189 0.66982355 0.31615073 0.67185202 60.27887 34 'point symmetry operation' ? ? 0.00770809 -0.02371854 -0.99968894 173.36135 -0.99984120 0.01588424 -0.00808616 -7.16439 0.01607107 0.99959242 -0.02359234 186.42109 35 'point symmetry operation' ? ? 0.38741379 -0.69478383 -0.60595864 99.71579 -0.69478392 -0.65206873 0.30344972 -66.51059 -0.60595870 0.30344970 -0.73534506 304.57120 36 'point symmetry operation' ? ? -0.47537489 -0.03665113 -0.87901957 151.81310 -0.33862752 0.92978001 0.14436254 -26.01262 0.81200379 0.36628654 -0.45440513 257.23511 37 'point symmetry operation' ? ? 0.01885427 -0.92992236 -0.36727210 55.92770 -0.86796838 0.16710432 -0.46766137 74.29527 0.49626149 0.32759799 -0.80399258 317.64541 38 'point symmetry operation' ? ? 0.72997099 -0.52988159 0.43170341 -79.69390 -0.52988164 -0.83769986 -0.13222863 8.15585 0.43170338 -0.13222861 -0.89227113 329.36913 39 'point symmetry operation' ? ? 0.67523613 0.61062843 0.41374996 -67.62726 0.20840833 -0.69602730 0.68710409 -133.02844 0.70754656 -0.37772855 -0.59724281 276.20448 40 'point symmetry operation' ? ? -0.06970859 0.91546161 -0.39632139 75.45193 0.32660988 0.39633532 0.85804684 -154.14572 0.94258514 -0.06962924 -0.32662673 231.62320 41 'point symmetry operation' ? ? -0.31194692 -0.39033487 -0.86621462 146.92972 0.94904239 -0.08501881 -0.30346407 45.17128 0.04480811 -0.91673899 0.39696573 98.00105 42 'point symmetry operation' ? ? 0.34795925 -0.92402813 -0.15841797 19.81720 0.81756928 0.38177542 -0.43107781 70.99686 0.45880815 0.02047985 0.88829931 20.02329 43 'point symmetry operation' ? ? 0.87595124 -0.16898086 0.45183502 -80.24299 0.48182508 0.35217524 -0.80238225 135.25013 -0.02353786 0.92055309 0.38990750 113.64255 44 'point symmetry operation' ? ? 0.54236209 0.83135728 0.12119547 -14.97106 0.40579686 -0.13291292 -0.90424727 149.13525 -0.73564415 0.53961012 -0.40944916 249.48019 45 'point symmetry operation' ? ? -0.19179936 0.69455298 -0.69340401 125.42940 0.69455303 -0.40311370 -0.59589888 93.46346 -0.69340401 -0.59589884 -0.40508694 239.81322 46 'point symmetry operation' ? ? 0.92401756 -0.18128398 -0.33664173 57.22753 -0.38234078 -0.44422945 -0.81023194 129.63460 -0.00266414 0.87738032 -0.47978811 265.01389 47 'point symmetry operation' ? ? 0.87279885 0.31270151 -0.37475312 67.72233 0.31270154 -0.94778817 -0.06257259 -4.16456 -0.37475316 -0.06257259 -0.92501067 334.96197 48 'point symmetry operation' ? ? 0.54236207 0.40579685 -0.73564412 131.12975 0.83135740 -0.13291296 0.53961018 -102.35374 0.12119547 -0.90424718 -0.40944911 238.81900 49 'point symmetry operation' ? ? 0.38935960 -0.03065255 -0.92057562 159.82289 0.45686204 0.87426634 0.16412025 -29.23884 0.79979761 -0.48447779 0.35440803 109.45130 50 'point symmetry operation' ? ? 0.62523566 -0.39348845 -0.67397858 114.14881 -0.29324469 0.68186216 -0.67012806 114.13784 0.72324816 0.61662856 0.31093615 125.64063 51 'point symmetry operation' ? ? -0.47537485 -0.33862750 0.81200378 -145.51634 -0.03665115 0.92978000 0.36628654 -64.47162 -0.87901959 0.14436256 -0.45440515 254.09090 52 'point symmetry operation' ? ? -0.41337439 0.14797213 0.89845746 -156.71306 -0.74176266 0.51756044 -0.42652016 69.98307 -0.52811916 -0.84275462 -0.10418605 185.52226 53 'point symmetry operation' ? ? -0.70706483 0.39882658 0.58394915 -100.12325 -0.67753983 -0.61853295 -0.39794072 56.10564 0.20248247 -0.67701868 0.70756381 45.84371 54 'point symmetry operation' ? ? -0.95057598 0.06726355 0.30311863 -53.95210 0.06726357 -0.90845772 0.41252904 -86.92578 0.30311868 0.41252895 0.85903370 28.08625 55 'point symmetry operation' ? ? -0.80738369 -0.38850814 0.44406414 -82.00657 0.46335457 0.04845231 0.88484747 -161.44662 -0.36528635 0.92017047 0.14089740 156.79009 56 'point symmetry operation' ? ? -0.13669579 0.91024634 0.39085257 -61.94492 -0.53005046 -0.40053174 0.74740947 -141.83026 0.83687562 -0.10500389 0.53722753 80.58216 57 'point symmetry operation' ? ? -0.80738371 0.46335450 -0.36528637 65.86953 -0.38850816 0.04845231 0.92017056 -168.31138 0.44406416 0.88484737 0.14089741 157.18048 58 'point symmetry operation' ? ? -0.71124848 -0.63564258 -0.30014006 45.93249 -0.63564265 0.39927067 0.66071280 -120.49803 -0.30014008 0.66071277 -0.68802220 299.38274 59 'point symmetry operation' ? ? 0.01885429 -0.86796828 0.49626152 -94.20373 -0.92992247 0.16710430 0.32759799 -64.46663 -0.36727215 -0.46766128 -0.80399258 310.67026 60 'point symmetry operation' ? ? 0.37394739 0.08744361 0.92331845 -160.87564 -0.86466291 -0.32720078 0.38117948 -77.65068 0.33544220 -0.94090019 -0.04674661 175.44406 # _pdbx_point_symmetry.entry_id 1C8F _pdbx_point_symmetry.Schoenflies_symbol I _pdbx_point_symmetry.H-M_notation 532 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 337 ? A ASP 373 ? 1_555 CA ? D CA . ? A CA 587 ? 1_555 OD2 ? A ASP 339 ? A ASP 375 ? 1_555 82.2 ? 2 OD1 ? A ASP 369 ? A ASP 405 ? 1_555 CA ? C CA . ? A CA 586 ? 1_555 OD2 ? A ASP 369 ? A ASP 405 ? 1_555 40.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-08-09 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-04 5 'Structure model' 2 0 2023-04-19 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation ? 'Coordinates and associated matrices have been transformed from the icosahedral point symmetry frame to the crystallographic frame' # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' Advisory 5 5 'Structure model' 'Atomic model' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' Other 10 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' atom_site 3 5 'Structure model' cell 4 5 'Structure model' database_2 5 5 'Structure model' database_PDB_matrix 6 5 'Structure model' pdbx_database_remark 7 5 'Structure model' pdbx_struct_conn_angle 8 5 'Structure model' pdbx_struct_oper_list 9 5 'Structure model' pdbx_validate_torsion 10 5 'Structure model' struct_conn 11 5 'Structure model' struct_ncs_oper 12 5 'Structure model' struct_ref_seq_dif 13 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_atom_site.Cartn_x' 2 5 'Structure model' '_atom_site.Cartn_y' 3 5 'Structure model' '_atom_site.Cartn_z' 4 5 'Structure model' '_cell.Z_PDB' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' 7 5 'Structure model' '_database_PDB_matrix.origx[1][1]' 8 5 'Structure model' '_database_PDB_matrix.origx[1][2]' 9 5 'Structure model' '_database_PDB_matrix.origx[1][3]' 10 5 'Structure model' '_database_PDB_matrix.origx[2][1]' 11 5 'Structure model' '_database_PDB_matrix.origx[2][2]' 12 5 'Structure model' '_database_PDB_matrix.origx[2][3]' 13 5 'Structure model' '_database_PDB_matrix.origx[3][1]' 14 5 'Structure model' '_database_PDB_matrix.origx[3][2]' 15 5 'Structure model' '_database_PDB_matrix.origx[3][3]' 16 5 'Structure model' '_database_PDB_matrix.origx_vector[1]' 17 5 'Structure model' '_database_PDB_matrix.origx_vector[2]' 18 5 'Structure model' '_database_PDB_matrix.origx_vector[3]' 19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 20 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 23 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 24 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 25 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 26 5 'Structure model' '_pdbx_struct_conn_angle.value' 27 5 'Structure model' '_pdbx_struct_oper_list.id' 28 5 'Structure model' '_pdbx_struct_oper_list.matrix[1][1]' 29 5 'Structure model' '_pdbx_struct_oper_list.matrix[1][2]' 30 5 'Structure model' '_pdbx_struct_oper_list.matrix[1][3]' 31 5 'Structure model' '_pdbx_struct_oper_list.matrix[2][1]' 32 5 'Structure model' '_pdbx_struct_oper_list.matrix[2][2]' 33 5 'Structure model' '_pdbx_struct_oper_list.matrix[2][3]' 34 5 'Structure model' '_pdbx_struct_oper_list.matrix[3][1]' 35 5 'Structure model' '_pdbx_struct_oper_list.matrix[3][2]' 36 5 'Structure model' '_pdbx_struct_oper_list.matrix[3][3]' 37 5 'Structure model' '_pdbx_struct_oper_list.name' 38 5 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 39 5 'Structure model' '_pdbx_struct_oper_list.type' 40 5 'Structure model' '_pdbx_struct_oper_list.vector[1]' 41 5 'Structure model' '_pdbx_struct_oper_list.vector[2]' 42 5 'Structure model' '_pdbx_struct_oper_list.vector[3]' 43 5 'Structure model' '_pdbx_validate_torsion.phi' 44 5 'Structure model' '_pdbx_validate_torsion.psi' 45 5 'Structure model' '_struct_conn.pdbx_dist_value' 46 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 47 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 48 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 49 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 50 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 51 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 52 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 53 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 54 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 55 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 56 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 57 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 58 5 'Structure model' '_struct_ref_seq_dif.details' 59 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 60 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 61 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal GLRF phasing . ? 1 TRANSF 'model building' . ? 2 ENVELOPE 'model building' . ? 3 CNS refinement 0.5 ? 4 TRANSF phasing . ? 5 ENVELOPE phasing . ? 6 # _pdbx_entry_details.entry_id 1C8F _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ;VIRUS GROWN IN A CELL CULTURE OF NORDEN LABORATORY FELINE KIDNEY CELLS ; _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 TYR _pdbx_validate_rmsd_angle.auth_seq_id_1 409 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 410 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 410 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 128.89 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 9.59 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 54 ? ? -104.28 -157.78 2 1 ASN A 86 ? ? -104.46 50.42 3 1 SER A 156 ? ? -69.46 70.12 4 1 ALA A 157 ? ? -51.83 50.42 5 1 GLN A 159 ? ? 63.46 -98.45 6 1 PRO A 161 ? ? -93.36 -157.82 7 1 PRO A 229 ? ? -23.55 -104.19 8 1 THR A 230 ? ? 177.32 101.89 9 1 GLN A 242 ? ? -154.19 82.91 10 1 ALA A 300 ? ? -70.99 44.16 11 1 THR A 301 ? ? -140.63 -28.50 12 1 GLN A 310 ? ? -48.69 -11.70 13 1 ASN A 321 ? ? -89.25 -73.86 14 1 ALA A 334 ? ? -145.14 -143.51 15 1 TYR A 343 ? ? 70.78 53.48 16 1 THR A 349 ? ? -25.29 -38.17 17 1 ARG A 361 ? ? -38.22 -111.35 18 1 ALA A 364 ? ? -35.62 171.55 19 1 THR A 366 ? ? 92.82 22.99 20 1 GLU A 368 ? ? -101.17 -135.81 21 1 ASN A 369 ? ? 159.46 53.76 22 1 GLN A 370 ? ? -28.48 -41.67 23 1 ARG A 382 ? ? 64.13 -68.25 24 1 GLN A 386 ? ? 3.38 123.00 25 1 LYS A 387 ? ? -36.20 134.12 26 1 GLU A 393 ? ? -148.93 47.99 27 1 PHE A 420 ? ? 52.05 -122.84 28 1 ASN A 421 ? ? 78.42 80.18 29 1 ASN A 426 ? ? -33.34 -39.13 30 1 PRO A 432 ? ? -61.19 4.44 31 1 THR A 450 ? ? -108.50 42.92 32 1 PRO A 453 ? ? -69.82 6.55 33 1 ASP A 475 ? ? -90.53 54.21 34 1 GLN A 491 ? ? -85.18 -81.41 35 1 ASN A 493 ? ? -170.23 144.77 36 1 ALA A 514 ? ? -175.72 93.59 37 1 SER A 515 ? ? -23.56 -54.60 38 1 ALA A 516 ? ? 28.04 -105.46 39 1 ASN A 517 ? ? 169.22 25.87 40 1 MET A 518 ? ? 33.90 96.24 41 1 PRO A 547 ? ? -67.11 -165.17 42 1 GLN A 558 ? ? -21.80 -62.30 43 1 GLN A 577 ? ? -82.22 47.58 44 1 ALA A 579 ? ? 142.92 119.66 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #