data_1C9Q # _entry.id 1C9Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1C9Q pdb_00001c9q 10.2210/pdb1c9q/pdb RCSB RCSB009467 ? ? WWPDB D_1000009467 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1C9Q _pdbx_database_status.recvd_initial_deposition_date 1999-08-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Meadows, R.P.' 1 'Fesik, S.W.' 2 # _citation.id primary _citation.title 'NMR structure and mutagenesis of the inhibitor-of-apoptosis protein XIAP.' _citation.journal_abbrev Nature _citation.journal_volume 401 _citation.page_first 818 _citation.page_last 822 _citation.year 1999 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10548111 _citation.pdbx_database_id_DOI 10.1038/44617 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sun, C.' 1 ? primary 'Cai, M.' 2 ? primary 'Gunasekera, A.H.' 3 ? primary 'Meadows, R.P.' 4 ? primary 'Wang, H.' 5 ? primary 'Chen, J.' 6 ? primary 'Zhang, H.' 7 ? primary 'Wu, W.' 8 ? primary 'Xu, N.' 9 ? primary 'Ng, S.C.' 10 ? primary 'Fesik, S.W.' 11 ? # _cell.entry_id 1C9Q _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1C9Q _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'APOPTOSIS INHIBITOR IAP HOMOLOG' 13580.107 1 ? 'C202A, C213G' 'BIR-2 DOMAIN (RESIDUES 124-240) OF HUMAN XIAP' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;RDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFAC GGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNLNIRSE ; _entity_poly.pdbx_seq_one_letter_code_can ;RDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFAC GGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNLNIRSE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 ASP n 1 3 HIS n 1 4 PHE n 1 5 ALA n 1 6 LEU n 1 7 ASP n 1 8 ARG n 1 9 PRO n 1 10 SER n 1 11 GLU n 1 12 THR n 1 13 HIS n 1 14 ALA n 1 15 ASP n 1 16 TYR n 1 17 LEU n 1 18 LEU n 1 19 ARG n 1 20 THR n 1 21 GLY n 1 22 GLN n 1 23 VAL n 1 24 VAL n 1 25 ASP n 1 26 ILE n 1 27 SER n 1 28 ASP n 1 29 THR n 1 30 ILE n 1 31 TYR n 1 32 PRO n 1 33 ARG n 1 34 ASN n 1 35 PRO n 1 36 ALA n 1 37 MET n 1 38 TYR n 1 39 SER n 1 40 GLU n 1 41 GLU n 1 42 ALA n 1 43 ARG n 1 44 LEU n 1 45 LYS n 1 46 SER n 1 47 PHE n 1 48 GLN n 1 49 ASN n 1 50 TRP n 1 51 PRO n 1 52 ASP n 1 53 TYR n 1 54 ALA n 1 55 HIS n 1 56 LEU n 1 57 THR n 1 58 PRO n 1 59 ARG n 1 60 GLU n 1 61 LEU n 1 62 ALA n 1 63 SER n 1 64 ALA n 1 65 GLY n 1 66 LEU n 1 67 TYR n 1 68 TYR n 1 69 THR n 1 70 GLY n 1 71 ILE n 1 72 GLY n 1 73 ASP n 1 74 GLN n 1 75 VAL n 1 76 GLN n 1 77 CYS n 1 78 PHE n 1 79 ALA n 1 80 CYS n 1 81 GLY n 1 82 GLY n 1 83 LYS n 1 84 LEU n 1 85 LYS n 1 86 ASN n 1 87 TRP n 1 88 GLU n 1 89 PRO n 1 90 GLY n 1 91 ASP n 1 92 ARG n 1 93 ALA n 1 94 TRP n 1 95 SER n 1 96 GLU n 1 97 HIS n 1 98 ARG n 1 99 ARG n 1 100 HIS n 1 101 PHE n 1 102 PRO n 1 103 ASN n 1 104 CYS n 1 105 PHE n 1 106 PHE n 1 107 VAL n 1 108 LEU n 1 109 GLY n 1 110 ARG n 1 111 ASN n 1 112 LEU n 1 113 ASN n 1 114 ILE n 1 115 ARG n 1 116 SER n 1 117 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BIRC4_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P98170 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1C9Q _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 117 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P98170 _struct_ref_seq.db_align_beg 124 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 117 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1C9Q ALA A 79 ? UNP P98170 CYS 202 'engineered mutation' 79 1 1 1C9Q GLY A 90 ? UNP P98170 CYS 213 'engineered mutation' 90 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-SEPARATED_NOESY 1 2 1 3D_13C-SEPARATED_NOESY 1 3 1 HNHA 1 4 1 'RESIDUAL DIPOLAR COUPLING IN PHAGE' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.6 MM XIAP U-15N,13C; 50 MM TRIS, 300MM NACL' _pdbx_nmr_sample_details.solvent_system ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AMX Bruker 800 ? 2 AMX Bruker 600 ? 3 AMX Bruker 500 ? # _pdbx_nmr_refine.entry_id 1C9Q _pdbx_nmr_refine.method 'TORSION ANGLE DYNAMICS, SIMULATED ANNEALING' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1C9Q _pdbx_nmr_details.text NONE # _pdbx_nmr_ensemble.entry_id 1C9Q _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria NONE _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1C9Q _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'data analysis' Dreamwalker 2.0 'OLEJNICZAK, E., MEADOWS, R.' 1 'structure solution' X-PLOR 3.8X 'BRUNGER, A.' 2 refinement X-PLOR 3.8X 'BRUNGER, A.' 3 # _exptl.entry_id 1C9Q _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1C9Q _struct.title 'AVERAGE NMR SOLUTION STRUCTURE OF THE BIR-2 DOMAIN OF XIAP' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1C9Q _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text 'ZINC FINGER, APOPTOSIS, INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? LEU A 6 ? ASP A 2 LEU A 6 5 ? 5 HELX_P HELX_P2 2 HIS A 13 ? LEU A 18 ? HIS A 13 LEU A 18 1 ? 6 HELX_P HELX_P3 3 ASN A 34 ? TYR A 38 ? ASN A 34 TYR A 38 5 ? 5 HELX_P HELX_P4 4 SER A 39 ? PHE A 47 ? SER A 39 PHE A 47 1 ? 9 HELX_P HELX_P5 5 THR A 57 ? ALA A 64 ? THR A 57 ALA A 64 1 ? 8 HELX_P HELX_P6 6 TRP A 94 ? PHE A 101 ? TRP A 94 PHE A 101 1 ? 8 HELX_P HELX_P7 7 CYS A 104 ? ARG A 110 ? CYS A 104 ARG A 110 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 77 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 77 A ZN 999 1_555 ? ? ? ? ? ? ? 2.099 ? ? metalc2 metalc ? ? A CYS 80 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 80 A ZN 999 1_555 ? ? ? ? ? ? ? 2.102 ? ? metalc3 metalc ? ? A HIS 97 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 97 A ZN 999 1_555 ? ? ? ? ? ? ? 2.207 ? ? metalc4 metalc ? ? A CYS 104 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 104 A ZN 999 1_555 ? ? ? ? ? ? ? 2.101 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 66 ? ILE A 71 ? LEU A 66 ILE A 71 A 2 GLN A 74 ? CYS A 77 ? GLN A 74 CYS A 77 A 3 GLY A 82 ? LEU A 84 ? GLY A 82 LEU A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 71 ? O ILE A 71 N GLN A 74 ? N GLN A 74 A 2 3 N CYS A 77 ? N CYS A 77 O GLY A 82 ? O GLY A 82 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 999 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 999' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 77 ? CYS A 77 . ? 1_555 ? 2 AC1 4 CYS A 80 ? CYS A 80 . ? 1_555 ? 3 AC1 4 HIS A 97 ? HIS A 97 . ? 1_555 ? 4 AC1 4 CYS A 104 ? CYS A 104 . ? 1_555 ? # _database_PDB_matrix.entry_id 1C9Q _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1C9Q _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 TRP 87 87 87 TRP TRP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 CYS 104 104 104 CYS CYS A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 GLU 117 117 117 GLU GLU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 999 _pdbx_nonpoly_scheme.auth_seq_num 999 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 77 ? A CYS 77 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 SG ? A CYS 80 ? A CYS 80 ? 1_555 109.0 ? 2 SG ? A CYS 77 ? A CYS 77 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 NE2 ? A HIS 97 ? A HIS 97 ? 1_555 109.5 ? 3 SG ? A CYS 80 ? A CYS 80 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 NE2 ? A HIS 97 ? A HIS 97 ? 1_555 109.7 ? 4 SG ? A CYS 77 ? A CYS 77 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 SG ? A CYS 104 ? A CYS 104 ? 1_555 108.5 ? 5 SG ? A CYS 80 ? A CYS 80 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 SG ? A CYS 104 ? A CYS 104 ? 1_555 109.2 ? 6 NE2 ? A HIS 97 ? A HIS 97 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 SG ? A CYS 104 ? A CYS 104 ? 1_555 110.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-08-09 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_ref_seq_dif.details' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -67.27 76.81 2 1 LEU A 6 ? ? -176.08 -38.76 3 1 ASP A 7 ? ? 75.45 55.94 4 1 ARG A 8 ? ? 33.72 55.88 5 1 GLU A 11 ? ? 70.43 123.57 6 1 THR A 12 ? ? -131.47 -46.17 7 1 THR A 20 ? ? -133.40 -54.34 8 1 GLN A 22 ? ? 72.63 124.50 9 1 VAL A 24 ? ? -53.22 107.99 10 1 ASP A 25 ? ? -54.16 -78.94 11 1 ASP A 28 ? ? -163.50 30.06 12 1 THR A 29 ? ? 48.17 -170.78 13 1 ILE A 30 ? ? -178.21 18.05 14 1 ASN A 34 ? ? -173.12 71.21 15 1 PHE A 47 ? ? -89.85 34.04 16 1 ASN A 49 ? ? 74.52 50.70 17 1 PRO A 51 ? ? -56.25 177.91 18 1 HIS A 55 ? ? 168.03 -38.97 19 1 ALA A 79 ? ? -78.94 -71.19 20 1 ASN A 86 ? ? 74.11 32.09 21 1 PHE A 101 ? ? -150.66 73.48 22 1 LEU A 108 ? ? -50.76 -84.80 23 1 ARG A 110 ? ? 69.32 -59.34 24 1 ASN A 111 ? ? 89.89 166.92 25 1 LEU A 112 ? ? 77.17 174.29 26 1 ASN A 113 ? ? -46.16 -90.78 27 1 ILE A 114 ? ? 32.20 38.32 28 1 ARG A 115 ? ? -56.73 -76.93 29 1 SER A 116 ? ? 75.67 -64.79 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #