data_1CKO # _entry.id 1CKO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1CKO pdb_00001cko 10.2210/pdb1cko/pdb WWPDB D_1000172363 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CKO _pdbx_database_status.recvd_initial_deposition_date 1997-09-06 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hakansson, K.' 1 'Wigley, D.B.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of a complex between a cap analogue and mRNA guanylyl transferase demonstrates the structural chemistry of RNA capping.' Proc.Natl.Acad.Sci.USA 95 1505 1510 1998 PNASA6 US 0027-8424 0040 ? 9465045 10.1073/pnas.95.4.1505 1 'Crystallization of the RNA Guanylyltransferase of Chlorella Virus Pbcv-1' 'Acta Crystallogr.,Sect.D' 53 482 ? 1997 ABCRE6 DK 0907-4449 0766 ? ? ? 2 'X-Ray Crystallography Reveals a Large Conformational Change During Guanyl Transfer by Mrna Capping Enzymes' 'Cell(Cambridge,Mass.)' 89 545 ? 1997 CELLB5 US 0092-8674 0998 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hakansson, K.' 1 ? primary 'Wigley, D.B.' 2 ? 1 'Doherty, A.J.' 3 ? 1 'Hakansson, K.' 4 ? 1 'Ho, C.K.' 5 ? 1 'Shuman, S.' 6 ? 1 'Wigley, D.B.' 7 ? 2 'Hakansson, K.' 8 ? 2 'Doherty, A.J.' 9 ? 2 'Shuman, S.' 10 ? 2 'Wigley, D.B.' 11 ? # _cell.entry_id 1CKO _cell.length_a 78.476 _cell.length_b 164.013 _cell.length_c 103.502 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1CKO _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MRNA CAPPING ENZYME' 37884.992 1 2.7.7.50 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn "DIGUANOSINE-5'-TRIPHOSPHATE" 788.406 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA GUANYLYLTRANSFERASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVPPTINTGKNITTERAVLTLNGLQIKLHKVVGESRDDIVAKMKDLAMDDHKFPRLPGPNPVSIERKDFEKLKQNKYVVS EKTDGIRFMMFFTRVFGFKVCTIIDRAMTVYLLPFKNIPRVLFQGSIFDGELCVDIVEKKFAFVLFDAVVVSGVTVSQMD LASRFFAMKRSLKEFKNVPEDPAILRYKEWIPLEHPTIIKDHLKKANAIYHTDGLIIMSVDEPVIYGRNFNLFKLKPGTH HTIDFIIMSEDGTIGIFDPNLRKNVPVGKLDGYYNKGSIVECGFADGTWKYIQGRSDKNQANDRLTYEKTLLNIEENITI DELLDLFKWE ; _entity_poly.pdbx_seq_one_letter_code_can ;MVPPTINTGKNITTERAVLTLNGLQIKLHKVVGESRDDIVAKMKDLAMDDHKFPRLPGPNPVSIERKDFEKLKQNKYVVS EKTDGIRFMMFFTRVFGFKVCTIIDRAMTVYLLPFKNIPRVLFQGSIFDGELCVDIVEKKFAFVLFDAVVVSGVTVSQMD LASRFFAMKRSLKEFKNVPEDPAILRYKEWIPLEHPTIIKDHLKKANAIYHTDGLIIMSVDEPVIYGRNFNLFKLKPGTH HTIDFIIMSEDGTIGIFDPNLRKNVPVGKLDGYYNKGSIVECGFADGTWKYIQGRSDKNQANDRLTYEKTLLNIEENITI DELLDLFKWE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 PRO n 1 4 PRO n 1 5 THR n 1 6 ILE n 1 7 ASN n 1 8 THR n 1 9 GLY n 1 10 LYS n 1 11 ASN n 1 12 ILE n 1 13 THR n 1 14 THR n 1 15 GLU n 1 16 ARG n 1 17 ALA n 1 18 VAL n 1 19 LEU n 1 20 THR n 1 21 LEU n 1 22 ASN n 1 23 GLY n 1 24 LEU n 1 25 GLN n 1 26 ILE n 1 27 LYS n 1 28 LEU n 1 29 HIS n 1 30 LYS n 1 31 VAL n 1 32 VAL n 1 33 GLY n 1 34 GLU n 1 35 SER n 1 36 ARG n 1 37 ASP n 1 38 ASP n 1 39 ILE n 1 40 VAL n 1 41 ALA n 1 42 LYS n 1 43 MET n 1 44 LYS n 1 45 ASP n 1 46 LEU n 1 47 ALA n 1 48 MET n 1 49 ASP n 1 50 ASP n 1 51 HIS n 1 52 LYS n 1 53 PHE n 1 54 PRO n 1 55 ARG n 1 56 LEU n 1 57 PRO n 1 58 GLY n 1 59 PRO n 1 60 ASN n 1 61 PRO n 1 62 VAL n 1 63 SER n 1 64 ILE n 1 65 GLU n 1 66 ARG n 1 67 LYS n 1 68 ASP n 1 69 PHE n 1 70 GLU n 1 71 LYS n 1 72 LEU n 1 73 LYS n 1 74 GLN n 1 75 ASN n 1 76 LYS n 1 77 TYR n 1 78 VAL n 1 79 VAL n 1 80 SER n 1 81 GLU n 1 82 LYS n 1 83 THR n 1 84 ASP n 1 85 GLY n 1 86 ILE n 1 87 ARG n 1 88 PHE n 1 89 MET n 1 90 MET n 1 91 PHE n 1 92 PHE n 1 93 THR n 1 94 ARG n 1 95 VAL n 1 96 PHE n 1 97 GLY n 1 98 PHE n 1 99 LYS n 1 100 VAL n 1 101 CYS n 1 102 THR n 1 103 ILE n 1 104 ILE n 1 105 ASP n 1 106 ARG n 1 107 ALA n 1 108 MET n 1 109 THR n 1 110 VAL n 1 111 TYR n 1 112 LEU n 1 113 LEU n 1 114 PRO n 1 115 PHE n 1 116 LYS n 1 117 ASN n 1 118 ILE n 1 119 PRO n 1 120 ARG n 1 121 VAL n 1 122 LEU n 1 123 PHE n 1 124 GLN n 1 125 GLY n 1 126 SER n 1 127 ILE n 1 128 PHE n 1 129 ASP n 1 130 GLY n 1 131 GLU n 1 132 LEU n 1 133 CYS n 1 134 VAL n 1 135 ASP n 1 136 ILE n 1 137 VAL n 1 138 GLU n 1 139 LYS n 1 140 LYS n 1 141 PHE n 1 142 ALA n 1 143 PHE n 1 144 VAL n 1 145 LEU n 1 146 PHE n 1 147 ASP n 1 148 ALA n 1 149 VAL n 1 150 VAL n 1 151 VAL n 1 152 SER n 1 153 GLY n 1 154 VAL n 1 155 THR n 1 156 VAL n 1 157 SER n 1 158 GLN n 1 159 MET n 1 160 ASP n 1 161 LEU n 1 162 ALA n 1 163 SER n 1 164 ARG n 1 165 PHE n 1 166 PHE n 1 167 ALA n 1 168 MET n 1 169 LYS n 1 170 ARG n 1 171 SER n 1 172 LEU n 1 173 LYS n 1 174 GLU n 1 175 PHE n 1 176 LYS n 1 177 ASN n 1 178 VAL n 1 179 PRO n 1 180 GLU n 1 181 ASP n 1 182 PRO n 1 183 ALA n 1 184 ILE n 1 185 LEU n 1 186 ARG n 1 187 TYR n 1 188 LYS n 1 189 GLU n 1 190 TRP n 1 191 ILE n 1 192 PRO n 1 193 LEU n 1 194 GLU n 1 195 HIS n 1 196 PRO n 1 197 THR n 1 198 ILE n 1 199 ILE n 1 200 LYS n 1 201 ASP n 1 202 HIS n 1 203 LEU n 1 204 LYS n 1 205 LYS n 1 206 ALA n 1 207 ASN n 1 208 ALA n 1 209 ILE n 1 210 TYR n 1 211 HIS n 1 212 THR n 1 213 ASP n 1 214 GLY n 1 215 LEU n 1 216 ILE n 1 217 ILE n 1 218 MET n 1 219 SER n 1 220 VAL n 1 221 ASP n 1 222 GLU n 1 223 PRO n 1 224 VAL n 1 225 ILE n 1 226 TYR n 1 227 GLY n 1 228 ARG n 1 229 ASN n 1 230 PHE n 1 231 ASN n 1 232 LEU n 1 233 PHE n 1 234 LYS n 1 235 LEU n 1 236 LYS n 1 237 PRO n 1 238 GLY n 1 239 THR n 1 240 HIS n 1 241 HIS n 1 242 THR n 1 243 ILE n 1 244 ASP n 1 245 PHE n 1 246 ILE n 1 247 ILE n 1 248 MET n 1 249 SER n 1 250 GLU n 1 251 ASP n 1 252 GLY n 1 253 THR n 1 254 ILE n 1 255 GLY n 1 256 ILE n 1 257 PHE n 1 258 ASP n 1 259 PRO n 1 260 ASN n 1 261 LEU n 1 262 ARG n 1 263 LYS n 1 264 ASN n 1 265 VAL n 1 266 PRO n 1 267 VAL n 1 268 GLY n 1 269 LYS n 1 270 LEU n 1 271 ASP n 1 272 GLY n 1 273 TYR n 1 274 TYR n 1 275 ASN n 1 276 LYS n 1 277 GLY n 1 278 SER n 1 279 ILE n 1 280 VAL n 1 281 GLU n 1 282 CYS n 1 283 GLY n 1 284 PHE n 1 285 ALA n 1 286 ASP n 1 287 GLY n 1 288 THR n 1 289 TRP n 1 290 LYS n 1 291 TYR n 1 292 ILE n 1 293 GLN n 1 294 GLY n 1 295 ARG n 1 296 SER n 1 297 ASP n 1 298 LYS n 1 299 ASN n 1 300 GLN n 1 301 ALA n 1 302 ASN n 1 303 ASP n 1 304 ARG n 1 305 LEU n 1 306 THR n 1 307 TYR n 1 308 GLU n 1 309 LYS n 1 310 THR n 1 311 LEU n 1 312 LEU n 1 313 ASN n 1 314 ILE n 1 315 GLU n 1 316 GLU n 1 317 ASN n 1 318 ILE n 1 319 THR n 1 320 ILE n 1 321 ASP n 1 322 GLU n 1 323 LEU n 1 324 LEU n 1 325 ASP n 1 326 LEU n 1 327 PHE n 1 328 LYS n 1 329 TRP n 1 330 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Chlorovirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Paramecium bursaria Chlorella virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10506 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MCE_CHVP1 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q84424 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MVPPTINTGKNITTERAVLTLNGLQIKLHKVVGESRDDIVAKMKDLAMDDHKFPRLPGPNPVSIERKDFEKLKQNKYVVS EKTDGIRFMMFFTRVFGFKVCTIIDRAMTVYLLPFKNIPRVLFQGSIFDGELCVDIVEKKFAFVLFDAVVVSGVTVSQMD LASRFFAMKRSLKEFKNVPEDPAILRYKEWIPLEHPTIIKDHLKKANAIYHTDGLIIMSVDEPVIYGRNFNLFKLKPGTH HTIDFIIMSEDGTIGIFDPNLRKNVPVGKLDGYYNKGSIVECGFADGTWKYIQGRSDKNQANDRLTYEKTLLNIEENITI DELLDLFKWE ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CKO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 330 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q84424 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 330 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 330 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GP3 non-polymer . "DIGUANOSINE-5'-TRIPHOSPHATE" ? 'C20 H27 N10 O18 P3' 788.406 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1CKO _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.4 _exptl_crystal.density_percent_sol 72.0 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_pH_range 6.5-7.5 _exptl_crystal_grow.pdbx_details ;HANGING DROP VAPOR DIFFUSION. 15 MG/ML PROTEIN IN 50 MM TRIS-HCL, 1.3 MM CAP ANALOG (GPPPG) 0.4 M NACL, 2 MM EDTA, 4 MM DTT, PH 7.5 WERE MIXED WITH AN EQUAL VOLUME OF AND EQUILIBRATED AGAINST 50 MM POTASSIUM PHOSPHATE, 5-10% PEG 8000, 2MM ZNCL2 PH 6.5., vapor diffusion - hanging drop ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'MAR scanner 300 mm plate' _diffrn_detector.pdbx_collection_date 1997-06 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.448 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SRS BEAMLINE PX7.2' _diffrn_source.pdbx_synchrotron_site SRS _diffrn_source.pdbx_synchrotron_beamline PX7.2 _diffrn_source.pdbx_wavelength 1.448 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1CKO _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 3.1 _reflns.number_obs 12014 _reflns.number_all ? _reflns.percent_possible_obs 96.8 _reflns.pdbx_Rmerge_I_obs 0.0350000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 107. _reflns.pdbx_redundancy 2.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 1CKO _refine.ls_number_reflns_obs 11642 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 3.1 _refine.ls_percent_reflns_obs 96.7 _refine.ls_R_factor_obs 0.2330000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2330000 _refine.ls_R_factor_R_free 0.3140000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 8.0 _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 72. _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'OPEN FORM OF PDB ENTRY 1CKM' _refine.pdbx_method_to_determine_struct ;MOLECULAR REPLACEMENT. THE ROTATION FUNCTION WAS SOLVED FOR EACH OF THE TWO DOMAINS SEPARATELY. TRANSLATION WAS PERFORMED WITH THE TWO DOMAINS INDEPENDENTLY BUT SIMULTANEOUSLY. ; _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_redundancy_reflns_obs ? _refine.pdbx_overall_phase_error ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2561 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 52 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2613 _refine_hist.d_res_high 3.1 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.015 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 3.169 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 24.98 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 2.575 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARAM19.PRO TOPH19.PEP 'X-RAY DIFFRACTION' 2 PARAM19.SOL 'USER DEFINED' 'X-RAY DIFFRACTION' 3 'USER DEFINED' ? 'X-RAY DIFFRACTION' # _struct.entry_id 1CKO _struct.title 'STRUCTURE OF MRNA CAPPING ENZYME IN COMPLEX WITH THE CAP ANALOG GPPPG' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CKO _struct_keywords.pdbx_keywords 'CAPPING ENZYME' _struct_keywords.text 'MRNA, CAPPING ENZYME, NUCLEOTIDYLTRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 34 ? ALA A 47 ? GLU A 34 ALA A 47 1 ? 14 HELX_P HELX_P2 2 ARG A 66 ? GLN A 74 ? ARG A 66 GLN A 74 5 ? 9 HELX_P HELX_P3 3 LEU A 122 ? GLN A 124 ? LEU A 122 GLN A 124 5 ? 3 HELX_P HELX_P4 4 LEU A 161 ? SER A 171 ? LEU A 161 SER A 171 1 ? 11 HELX_P HELX_P5 5 PRO A 196 ? ALA A 208 ? PRO A 196 ALA A 208 1 ? 13 HELX_P HELX_P6 6 ARG A 304 ? GLU A 316 ? ARG A 304 GLU A 316 1 ? 13 HELX_P HELX_P7 7 ILE A 320 ? LEU A 323 ? ILE A 320 LEU A 323 1 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 3 ? C ? 3 ? D ? 2 ? E ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel E 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 14 ? LEU A 21 ? THR A 14 LEU A 21 A 2 LEU A 24 ? VAL A 31 ? LEU A 24 VAL A 31 A 3 VAL A 110 ? LEU A 112 ? VAL A 110 LEU A 112 A 4 PHE A 98 ? ILE A 104 ? PHE A 98 ILE A 104 A 5 ILE A 86 ? VAL A 95 ? ILE A 86 VAL A 95 A 6 SER A 126 ? ASP A 135 ? SER A 126 ASP A 135 A 7 LYS A 140 ? LEU A 145 ? LYS A 140 LEU A 145 A 8 ILE A 184 ? TYR A 187 ? ILE A 184 TYR A 187 B 1 TYR A 77 ? GLU A 81 ? TYR A 77 GLU A 81 B 2 LEU A 215 ? SER A 219 ? LEU A 215 SER A 219 B 3 LEU A 232 ? LEU A 235 ? LEU A 232 LEU A 235 C 1 THR A 242 ? ILE A 246 ? THR A 242 ILE A 246 C 2 ILE A 279 ? ALA A 285 ? ILE A 279 ALA A 285 C 3 THR A 288 ? GLY A 294 ? THR A 288 GLY A 294 D 1 ILE A 127 ? ASP A 129 ? ILE A 127 ASP A 129 D 2 ASP A 147 ? VAL A 150 ? ASP A 147 VAL A 150 E 1 THR A 253 ? ASP A 258 ? THR A 253 ASP A 258 E 2 LYS A 263 ? LYS A 269 ? LYS A 263 LYS A 269 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 15 ? O GLU A 15 N LYS A 30 ? N LYS A 30 A 2 3 O HIS A 29 ? O HIS A 29 N LEU A 112 ? N LEU A 112 A 3 4 O TYR A 111 ? O TYR A 111 N ILE A 103 ? N ILE A 103 A 4 5 O PHE A 98 ? O PHE A 98 N VAL A 95 ? N VAL A 95 A 5 6 O ILE A 86 ? O ILE A 86 N LEU A 132 ? N LEU A 132 A 6 7 O GLU A 131 ? O GLU A 131 N VAL A 144 ? N VAL A 144 A 7 8 O PHE A 143 ? O PHE A 143 N ILE A 184 ? N ILE A 184 B 1 2 O VAL A 78 ? O VAL A 78 N MET A 218 ? N MET A 218 B 2 3 O LEU A 215 ? O LEU A 215 N LEU A 235 ? N LEU A 235 C 1 2 O ILE A 243 ? O ILE A 243 N CYS A 282 ? N CYS A 282 C 2 3 O GLU A 281 ? O GLU A 281 N GLN A 293 ? N GLN A 293 D 1 2 O ILE A 127 ? O ILE A 127 N VAL A 150 ? N VAL A 150 E 1 2 O ILE A 254 ? O ILE A 254 N GLY A 268 ? N GLY A 268 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 888 ? 1 'BINDING SITE FOR RESIDUE ZN A 888' AC2 Software A GP3 999 ? 15 'BINDING SITE FOR RESIDUE GP3 A 999' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 HIS A 195 ? HIS A 195 . ? 1_555 ? 2 AC2 15 PRO A 59 ? PRO A 59 . ? 1_555 ? 3 AC2 15 PRO A 61 ? PRO A 61 . ? 1_555 ? 4 AC2 15 LYS A 82 ? LYS A 82 . ? 1_555 ? 5 AC2 15 GLY A 85 ? GLY A 85 . ? 1_555 ? 6 AC2 15 ILE A 86 ? ILE A 86 . ? 1_555 ? 7 AC2 15 ARG A 87 ? ARG A 87 . ? 1_555 ? 8 AC2 15 ASP A 105 ? ASP A 105 . ? 1_555 ? 9 AC2 15 ARG A 106 ? ARG A 106 . ? 1_555 ? 10 AC2 15 GLU A 131 ? GLU A 131 . ? 1_555 ? 11 AC2 15 PHE A 146 ? PHE A 146 . ? 1_555 ? 12 AC2 15 LYS A 188 ? LYS A 188 . ? 1_555 ? 13 AC2 15 TRP A 190 ? TRP A 190 . ? 1_555 ? 14 AC2 15 LEU A 232 ? LEU A 232 . ? 1_555 ? 15 AC2 15 LYS A 234 ? LYS A 234 . ? 1_555 ? 16 AC2 15 LYS A 236 ? LYS A 236 . ? 1_555 ? # _database_PDB_matrix.entry_id 1CKO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CKO _atom_sites.fract_transf_matrix[1][1] 0.012743 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006097 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009662 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 ILE 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 THR 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 MET 108 108 108 MET MET A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 CYS 133 133 133 CYS CYS A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 MET 159 159 159 MET MET A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 MET 168 168 168 MET MET A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 TYR 187 187 187 TYR TYR A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 TRP 190 190 190 TRP TRP A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 HIS 195 195 195 HIS HIS A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 HIS 202 202 202 HIS HIS A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 TYR 210 210 210 TYR TYR A . n A 1 211 HIS 211 211 211 HIS HIS A . n A 1 212 THR 212 212 212 THR THR A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 ILE 217 217 217 ILE ILE A . n A 1 218 MET 218 218 218 MET MET A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 VAL 220 220 220 VAL VAL A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 ARG 228 228 228 ARG ARG A . n A 1 229 ASN 229 229 229 ASN ASN A . n A 1 230 PHE 230 230 230 PHE PHE A . n A 1 231 ASN 231 231 231 ASN ASN A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 LYS 234 234 234 LYS LYS A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 LYS 236 236 236 LYS LYS A . n A 1 237 PRO 237 237 237 PRO PRO A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 THR 239 239 239 THR THR A . n A 1 240 HIS 240 240 240 HIS HIS A . n A 1 241 HIS 241 241 241 HIS HIS A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 ASP 244 244 244 ASP ASP A . n A 1 245 PHE 245 245 245 PHE PHE A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 ILE 247 247 247 ILE ILE A . n A 1 248 MET 248 248 248 MET MET A . n A 1 249 SER 249 249 249 SER SER A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 ASP 251 251 251 ASP ASP A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 THR 253 253 253 THR THR A . n A 1 254 ILE 254 254 254 ILE ILE A . n A 1 255 GLY 255 255 255 GLY GLY A . n A 1 256 ILE 256 256 256 ILE ILE A . n A 1 257 PHE 257 257 257 PHE PHE A . n A 1 258 ASP 258 258 258 ASP ASP A . n A 1 259 PRO 259 259 259 PRO PRO A . n A 1 260 ASN 260 260 260 ASN ASN A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 ARG 262 262 262 ARG ARG A . n A 1 263 LYS 263 263 263 LYS LYS A . n A 1 264 ASN 264 264 264 ASN ASN A . n A 1 265 VAL 265 265 265 VAL VAL A . n A 1 266 PRO 266 266 266 PRO PRO A . n A 1 267 VAL 267 267 267 VAL VAL A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 LYS 269 269 269 LYS LYS A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 ASP 271 271 271 ASP ASP A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 TYR 273 273 273 TYR TYR A . n A 1 274 TYR 274 274 274 TYR TYR A . n A 1 275 ASN 275 275 275 ASN ASN A . n A 1 276 LYS 276 276 276 LYS LYS A . n A 1 277 GLY 277 277 277 GLY GLY A . n A 1 278 SER 278 278 278 SER SER A . n A 1 279 ILE 279 279 279 ILE ILE A . n A 1 280 VAL 280 280 280 VAL VAL A . n A 1 281 GLU 281 281 281 GLU GLU A . n A 1 282 CYS 282 282 282 CYS CYS A . n A 1 283 GLY 283 283 283 GLY GLY A . n A 1 284 PHE 284 284 284 PHE PHE A . n A 1 285 ALA 285 285 285 ALA ALA A . n A 1 286 ASP 286 286 286 ASP ASP A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 THR 288 288 288 THR THR A . n A 1 289 TRP 289 289 289 TRP TRP A . n A 1 290 LYS 290 290 290 LYS LYS A . n A 1 291 TYR 291 291 291 TYR TYR A . n A 1 292 ILE 292 292 292 ILE ILE A . n A 1 293 GLN 293 293 293 GLN GLN A . n A 1 294 GLY 294 294 294 GLY GLY A . n A 1 295 ARG 295 295 295 ARG ARG A . n A 1 296 SER 296 296 296 SER SER A . n A 1 297 ASP 297 297 297 ASP ASP A . n A 1 298 LYS 298 298 298 LYS LYS A . n A 1 299 ASN 299 299 299 ASN ASN A . n A 1 300 GLN 300 300 300 GLN GLN A . n A 1 301 ALA 301 301 301 ALA ALA A . n A 1 302 ASN 302 302 302 ASN ASN A . n A 1 303 ASP 303 303 303 ASP ASP A . n A 1 304 ARG 304 304 304 ARG ARG A . n A 1 305 LEU 305 305 305 LEU LEU A . n A 1 306 THR 306 306 306 THR THR A . n A 1 307 TYR 307 307 307 TYR TYR A . n A 1 308 GLU 308 308 308 GLU GLU A . n A 1 309 LYS 309 309 309 LYS LYS A . n A 1 310 THR 310 310 310 THR THR A . n A 1 311 LEU 311 311 311 LEU LEU A . n A 1 312 LEU 312 312 312 LEU LEU A . n A 1 313 ASN 313 313 313 ASN ASN A . n A 1 314 ILE 314 314 314 ILE ILE A . n A 1 315 GLU 315 315 315 GLU GLU A . n A 1 316 GLU 316 316 316 GLU GLU A . n A 1 317 ASN 317 317 317 ASN ASN A . n A 1 318 ILE 318 318 318 ILE ILE A . n A 1 319 THR 319 319 319 THR THR A . n A 1 320 ILE 320 320 320 ILE ILE A . n A 1 321 ASP 321 321 321 ASP ASP A . n A 1 322 GLU 322 322 322 GLU GLU A . n A 1 323 LEU 323 323 323 LEU LEU A . n A 1 324 LEU 324 324 324 LEU LEU A . n A 1 325 ASP 325 325 325 ASP ASP A . n A 1 326 LEU 326 326 326 LEU LEU A . n A 1 327 PHE 327 327 327 PHE PHE A . n A 1 328 LYS 328 328 ? ? ? A . n A 1 329 TRP 329 329 ? ? ? A . n A 1 330 GLU 330 330 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 888 888 ZN ZN A . C 3 GP3 1 999 999 GP3 GP3 A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PQS monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 3040 ? 2 MORE -63 ? 2 'SSA (A^2)' 31970 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_565 x,-y+1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 164.0130000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-01-28 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_initial_refinement_model 3 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 4 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 5 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 X-PLOR refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 29 ? ? CD2 A HIS 29 ? ? 1.306 1.373 -0.067 0.011 N 2 1 NE2 A HIS 51 ? ? CD2 A HIS 51 ? ? 1.302 1.373 -0.071 0.011 N 3 1 NE2 A HIS 195 ? ? CD2 A HIS 195 ? ? 1.300 1.373 -0.073 0.011 N 4 1 NE2 A HIS 240 ? ? CD2 A HIS 240 ? ? 1.303 1.373 -0.070 0.011 N 5 1 NE2 A HIS 241 ? ? CD2 A HIS 241 ? ? 1.296 1.373 -0.077 0.011 N 6 1 CG A TRP 289 ? ? CD2 A TRP 289 ? ? 1.328 1.432 -0.104 0.017 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A ARG 66 ? ? CB A ARG 66 ? ? CG A ARG 66 ? ? 99.84 113.40 -13.56 2.20 N 2 1 NE A ARG 120 ? ? CZ A ARG 120 ? ? NH1 A ARG 120 ? ? 124.46 120.30 4.16 0.50 N 3 1 NE A ARG 120 ? ? CZ A ARG 120 ? ? NH2 A ARG 120 ? ? 116.23 120.30 -4.07 0.50 N 4 1 CB A PHE 146 ? ? CA A PHE 146 ? ? C A PHE 146 ? ? 98.31 110.40 -12.09 2.00 N 5 1 NE A ARG 164 ? ? CZ A ARG 164 ? ? NH2 A ARG 164 ? ? 125.00 120.30 4.70 0.50 N 6 1 NE A ARG 170 ? ? CZ A ARG 170 ? ? NH2 A ARG 170 ? ? 116.89 120.30 -3.41 0.50 N 7 1 CA A LYS 173 ? ? CB A LYS 173 ? ? CG A LYS 173 ? ? 126.96 113.40 13.56 2.20 N 8 1 CD1 A TRP 190 ? ? CG A TRP 190 ? ? CD2 A TRP 190 ? ? 112.55 106.30 6.25 0.80 N 9 1 CE2 A TRP 190 ? ? CD2 A TRP 190 ? ? CG A TRP 190 ? ? 101.46 107.30 -5.84 0.80 N 10 1 CA A LEU 235 ? ? C A LEU 235 ? ? N A LYS 236 ? ? 103.54 117.20 -13.66 2.20 Y 11 1 CA A CYS 282 ? ? CB A CYS 282 ? ? SG A CYS 282 ? ? 102.80 114.00 -11.20 1.80 N 12 1 CD1 A TRP 289 ? ? CG A TRP 289 ? ? CD2 A TRP 289 ? ? 112.91 106.30 6.61 0.80 N 13 1 CE2 A TRP 289 ? ? CD2 A TRP 289 ? ? CG A TRP 289 ? ? 102.15 107.30 -5.15 0.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 57 ? ? -62.98 70.54 2 1 LYS A 67 ? ? -36.83 -31.36 3 1 ASN A 117 ? ? -81.07 37.70 4 1 MET A 159 ? ? -56.16 -157.31 5 1 GLU A 194 ? ? -71.55 27.61 6 1 ASP A 213 ? ? -143.97 40.39 7 1 PHE A 230 ? ? -57.97 -8.84 8 1 VAL A 267 ? ? -141.39 -1.29 9 1 ASP A 325 ? ? -162.70 -33.76 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 77 ? ? 0.074 'SIDE CHAIN' 2 1 ARG A 87 ? ? 0.092 'SIDE CHAIN' 3 1 PHE A 91 ? ? 0.076 'SIDE CHAIN' 4 1 TYR A 111 ? ? 0.074 'SIDE CHAIN' 5 1 TYR A 187 ? ? 0.076 'SIDE CHAIN' 6 1 TYR A 226 ? ? 0.079 'SIDE CHAIN' 7 1 TYR A 273 ? ? 0.138 'SIDE CHAIN' 8 1 PHE A 284 ? ? 0.088 'SIDE CHAIN' 9 1 ARG A 304 ? ? 0.122 'SIDE CHAIN' 10 1 TYR A 307 ? ? 0.064 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A ILE 6 ? A ILE 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A THR 8 ? A THR 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A LYS 328 ? A LYS 328 12 1 Y 1 A TRP 329 ? A TRP 329 13 1 Y 1 A GLU 330 ? A GLU 330 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 "DIGUANOSINE-5'-TRIPHOSPHATE" GP3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1CKM _pdbx_initial_refinement_model.details 'OPEN FORM OF PDB ENTRY 1CKM' #