data_1CTX # _entry.id 1CTX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1CTX WWPDB D_1000172531 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CTX _pdbx_database_status.recvd_initial_deposition_date 1982-04-08 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Saenger, W.' 1 'Walkinshaw, M.D.' 2 # _citation.id primary _citation.title ;Three-dimensional structure of the "long" neurotoxin from cobra venom. ; _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 77 _citation.page_first 2400 _citation.page_last 2404 _citation.year 1980 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 6930640 _citation.pdbx_database_id_DOI 10.1073/pnas.77.5.2400 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Walkinshaw, M.D.' 1 primary 'Saenger, W.' 2 primary 'Maelicke, A.' 3 # _cell.entry_id 1CTX _cell.length_a 74.600 _cell.length_b 74.600 _cell.length_c 42.900 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CTX _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description ALPHA-COBRATOXIN _entity.formula_weight 7842.094 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP _entity_poly.pdbx_seq_one_letter_code_can IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 ARG n 1 3 CYS n 1 4 PHE n 1 5 ILE n 1 6 THR n 1 7 PRO n 1 8 ASP n 1 9 ILE n 1 10 THR n 1 11 SER n 1 12 LYS n 1 13 ASP n 1 14 CYS n 1 15 PRO n 1 16 ASN n 1 17 GLY n 1 18 HIS n 1 19 VAL n 1 20 CYS n 1 21 TYR n 1 22 THR n 1 23 LYS n 1 24 THR n 1 25 TRP n 1 26 CYS n 1 27 ASP n 1 28 ALA n 1 29 PHE n 1 30 CYS n 1 31 SER n 1 32 ILE n 1 33 ARG n 1 34 GLY n 1 35 LYS n 1 36 ARG n 1 37 VAL n 1 38 ASP n 1 39 LEU n 1 40 GLY n 1 41 CYS n 1 42 ALA n 1 43 ALA n 1 44 THR n 1 45 CYS n 1 46 PRO n 1 47 THR n 1 48 VAL n 1 49 LYS n 1 50 THR n 1 51 GLY n 1 52 VAL n 1 53 ASP n 1 54 ILE n 1 55 GLN n 1 56 CYS n 1 57 CYS n 1 58 SER n 1 59 THR n 1 60 ASP n 1 61 ASN n 1 62 CYS n 1 63 ASN n 1 64 PRO n 1 65 PHE n 1 66 PRO n 1 67 THR n 1 68 ARG n 1 69 LYS n 1 70 ARG n 1 71 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Naja _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Naja siamensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 84476 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NXL1_NAJKA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01391 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CTX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01391 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 71 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1CTX _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_percent_sol 43.97 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1CTX _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 2.8 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 541 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 541 _refine_hist.d_res_high 2.8 _refine_hist.d_res_low . # _struct.entry_id 1CTX _struct.title 'THREE-DIMENSIONAL STRUCTURE OF THE-LONG-NEUROTOXIN FROM COBRA VENOM' _struct.pdbx_descriptor 'ALPHA COBRATOXIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CTX _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PHE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 29 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 34 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PHE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 29 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 34 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 3 A CYS 20 1_555 ? ? ? ? ? ? ? 2.034 ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 14 A CYS 41 1_555 ? ? ? ? ? ? ? 1.997 ? disulf3 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 26 A CYS 30 1_555 ? ? ? ? ? ? ? 2.085 ? disulf4 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 56 SG ? ? A CYS 45 A CYS 56 1_555 ? ? ? ? ? ? ? 2.037 ? disulf5 disulf ? ? A CYS 57 SG ? ? ? 1_555 A CYS 62 SG ? ? A CYS 57 A CYS 62 1_555 ? ? ? ? ? ? ? 1.991 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 THR 6 A . ? THR 6 A PRO 7 A ? PRO 7 A 1 -16.16 2 CYS 14 A . ? CYS 14 A PRO 15 A ? PRO 15 A 1 -16.04 3 ARG 70 A . ? ARG 70 A PRO 71 A ? PRO 71 A 1 22.38 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 36 ? GLY A 40 ? ARG A 36 GLY A 40 A 2 CYS A 20 ? TRP A 25 ? CYS A 20 TRP A 25 A 3 ASP A 53 ? CYS A 57 ? ASP A 53 CYS A 57 # _database_PDB_matrix.entry_id 1CTX _database_PDB_matrix.origx[1][1] .013405 _database_PDB_matrix.origx[1][2] .007739 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] .015479 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] .023310 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CTX _atom_sites.fract_transf_matrix[1][1] .013405 _atom_sites.fract_transf_matrix[1][2] .007739 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] .015479 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] .023310 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 PRO 71 71 71 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z+2/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 28.6000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1982-05-26 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 3 ? ? O A VAL 19 ? ? 1.43 2 1 CD1 A ILE 1 ? ? N A VAL 19 ? ? 1.69 3 1 OG1 A THR 67 ? ? O A PRO 71 ? ? 1.84 4 1 O A THR 67 ? ? N A LYS 69 ? ? 1.86 5 1 OG1 A THR 67 ? ? C A PRO 71 ? ? 1.95 6 1 SG A CYS 3 ? ? C A VAL 19 ? ? 2.02 7 1 NZ A LYS 35 ? ? O A LYS 69 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 CG2 A THR 10 ? ? 1_555 N A ALA 28 ? ? 5_565 0.54 2 1 OD1 A ASP 53 ? ? 1_555 OE1 A GLN 55 ? ? 7_555 1.30 3 1 O A PRO 71 ? ? 1_555 O A PRO 71 ? ? 7_555 1.43 4 1 CG2 A THR 10 ? ? 1_555 C A ASP 27 ? ? 5_565 1.46 5 1 O A ILE 54 ? ? 1_555 CG A GLN 55 ? ? 7_555 1.51 6 1 CG2 A THR 10 ? ? 1_555 CA A ALA 28 ? ? 5_565 1.55 7 1 O A CYS 14 ? ? 1_555 O A CYS 14 ? ? 10_665 1.62 8 1 CB A THR 10 ? ? 1_555 N A ALA 28 ? ? 5_565 1.76 9 1 CG A ASP 53 ? ? 1_555 OE1 A GLN 55 ? ? 7_555 1.94 10 1 OG1 A THR 67 ? ? 1_555 CB A PRO 71 ? ? 7_555 2.11 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 N A CYS 3 ? ? CA A CYS 3 ? ? 1.790 1.459 0.331 0.020 N 2 1 CA A CYS 3 ? ? C A CYS 3 ? ? 1.719 1.525 0.194 0.026 N 3 1 CA A CYS 14 ? ? CB A CYS 14 ? ? 1.050 1.526 -0.476 0.013 N 4 1 CB A CYS 14 ? ? SG A CYS 14 ? ? 2.404 1.818 0.586 0.017 N 5 1 CE1 A HIS 18 ? ? NE2 A HIS 18 ? ? 1.242 1.317 -0.075 0.011 N 6 1 CA A VAL 19 ? ? CB A VAL 19 ? ? 1.405 1.543 -0.138 0.021 N 7 1 NE A ARG 36 ? ? CZ A ARG 36 ? ? 1.415 1.326 0.089 0.013 N 8 1 N A GLY 40 ? ? CA A GLY 40 ? ? 1.547 1.456 0.091 0.015 N 9 1 N A GLY 51 ? ? CA A GLY 51 ? ? 1.593 1.456 0.137 0.015 N 10 1 CA A GLY 51 ? ? C A GLY 51 ? ? 1.616 1.514 0.102 0.016 N 11 1 N A ARG 70 ? ? CA A ARG 70 ? ? 1.579 1.459 0.120 0.020 N 12 1 N A PRO 71 ? ? CA A PRO 71 ? ? 1.573 1.468 0.105 0.017 N 13 1 CA A PRO 71 ? ? C A PRO 71 ? ? 1.373 1.524 -0.151 0.020 N 14 1 C A PRO 71 ? ? OXT A PRO 71 ? ? 2.120 1.229 0.891 0.019 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A ARG 2 ? ? N A CYS 3 ? ? CA A CYS 3 ? ? 142.73 121.70 21.03 2.50 Y 2 1 CB A CYS 3 ? ? CA A CYS 3 ? ? C A CYS 3 ? ? 147.07 111.50 35.57 1.20 N 3 1 N A CYS 3 ? ? CA A CYS 3 ? ? C A CYS 3 ? ? 91.62 111.00 -19.38 2.70 N 4 1 O A PRO 7 ? ? C A PRO 7 ? ? N A ASP 8 ? ? 135.69 122.70 12.99 1.60 Y 5 1 CB A CYS 14 ? ? CA A CYS 14 ? ? C A CYS 14 ? ? 120.66 111.50 9.16 1.20 N 6 1 N A CYS 14 ? ? CA A CYS 14 ? ? CB A CYS 14 ? ? 89.47 110.60 -21.13 1.80 N 7 1 CB A ALA 28 ? ? CA A ALA 28 ? ? C A ALA 28 ? ? 101.09 110.10 -9.01 1.50 N 8 1 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH2 A ARG 33 ? ? 125.05 120.30 4.75 0.50 N 9 1 CA A LYS 49 ? ? C A LYS 49 ? ? N A THR 50 ? ? 101.02 117.20 -16.18 2.20 Y 10 1 O A LYS 49 ? ? C A LYS 49 ? ? N A THR 50 ? ? 140.04 122.70 17.34 1.60 Y 11 1 C A LYS 49 ? ? N A THR 50 ? ? CA A THR 50 ? ? 141.89 121.70 20.19 2.50 Y 12 1 CB A ASP 53 ? ? CG A ASP 53 ? ? OD2 A ASP 53 ? ? 123.76 118.30 5.46 0.90 N 13 1 CB A ASP 60 ? ? CG A ASP 60 ? ? OD2 A ASP 60 ? ? 125.87 118.30 7.57 0.90 N 14 1 NE A ARG 68 ? ? CZ A ARG 68 ? ? NH2 A ARG 68 ? ? 123.44 120.30 3.14 0.50 N 15 1 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH2 A ARG 70 ? ? 124.49 120.30 4.19 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 2 ? ? -108.34 63.07 2 1 CYS A 3 ? ? -37.44 119.07 3 1 ILE A 5 ? ? 65.14 160.70 4 1 ASP A 8 ? ? -44.31 55.63 5 1 ILE A 9 ? ? 44.66 -116.37 6 1 SER A 11 ? ? -177.61 -140.81 7 1 LYS A 12 ? ? 163.78 -153.25 8 1 ASP A 13 ? ? 38.64 97.46 9 1 VAL A 19 ? ? 171.41 171.98 10 1 ASP A 27 ? ? -172.05 143.07 11 1 ALA A 28 ? ? 1.77 -50.51 12 1 CYS A 30 ? ? -50.83 -91.41 13 1 SER A 31 ? ? -5.64 -89.09 14 1 ARG A 33 ? ? -149.80 -0.20 15 1 ALA A 42 ? ? -125.31 -124.83 16 1 ALA A 43 ? ? -174.21 103.92 17 1 THR A 44 ? ? 109.45 146.85 18 1 VAL A 48 ? ? -110.81 -82.53 19 1 LYS A 49 ? ? 47.65 112.58 20 1 THR A 50 ? ? 66.85 -142.51 21 1 THR A 59 ? ? -22.58 89.98 22 1 ASP A 60 ? ? -16.35 -73.18 23 1 ASN A 63 ? ? -161.78 10.22 24 1 PRO A 64 ? ? -59.56 -172.85 25 1 THR A 67 ? ? -21.04 106.97 26 1 ARG A 68 ? ? 7.43 -13.64 27 1 LYS A 69 ? ? -152.89 -24.15 28 1 ARG A 70 ? ? 80.75 81.31 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id CYS _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 3 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -12.06 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id CYS _pdbx_validate_chiral.auth_seq_id 14 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . #