data_1DK3 # _entry.id 1DK3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DK3 pdb_00001dk3 10.2210/pdb1dk3/pdb RCSB RCSB010148 ? ? WWPDB D_1000010148 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1BNO 'THIS IS THE PREVIOUS MINIMIZED AVERAGE STRUCTURE.' unspecified PDB 1BNP 'THIS IS A PREVIOUS GROUP OF 55 STRUCTURAL CONFORMERS.' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DK3 _pdbx_database_status.recvd_initial_deposition_date 1999-12-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Maciejewski, M.W.' 1 'Prasad, R.' 2 'Liu, D.-J.' 3 'Wilson, S.H.' 4 'Mullen, G.P.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Backbone dynamics and refined solution structure of the N-terminal domain of DNA polymerase beta. Correlation with DNA binding and dRP lyase activity. ; J.Mol.Biol. 296 229 253 2000 JMOBAK UK 0022-2836 0070 ? 10656829 10.1006/jmbi.1999.3455 1 'Three-Dimensional Solution Structure of the N-terminal Domain of DNA Polymerase beta and Mapping of the ssDNA Interaction Interface' Biochemistry 35 6188 6200 1996 BICHAW US 0006-2960 0033 ? ? 10.1021/bi952656o 2 ;Assignments of 1H, 15N, and 13C Resonances for the Backbone and Side Chains of the N-terminal domain of DNA Polymerase beta. Determination of the Secondary Structure and Tertiary Contacts. ; Biochemistry 33 9537 9545 1994 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Maciejewski, M.W.' 1 ? primary 'Liu, D.' 2 ? primary 'Prasad, R.' 3 ? primary 'Wilson, S.H.' 4 ? primary 'Mullen, G.P.' 5 ? 1 'Liu, D.-J.' 6 ? 1 'Prasad, R.' 7 ? 1 'Wilson, S.H.' 8 ? 1 'DeRose, E.F.' 9 ? 1 'Mullen, G.P.' 10 ? 2 'Liu, D.-J.' 11 ? 2 'DeRose, E.F.' 12 ? 2 'Prasad, R.' 13 ? 2 'Wilson, S.H.' 14 ? 2 'Mullen, G.P.' 15 ? # _cell.entry_id 1DK3 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DK3 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DNA POLYMERASE BETA' _entity.formula_weight 9632.298 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.7.7 _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-TERMINAL DOMAIN, RESIDUES 1-87' _entity.details ? # _entity_name_sys.entity_id 1 _entity_name_sys.name E.C.2.7.7.7 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATG KLRKLEK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATG KLRKLEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LYS n 1 4 ARG n 1 5 LYS n 1 6 ALA n 1 7 PRO n 1 8 GLN n 1 9 GLU n 1 10 THR n 1 11 LEU n 1 12 ASN n 1 13 GLY n 1 14 GLY n 1 15 ILE n 1 16 THR n 1 17 ASP n 1 18 MET n 1 19 LEU n 1 20 VAL n 1 21 GLU n 1 22 LEU n 1 23 ALA n 1 24 ASN n 1 25 PHE n 1 26 GLU n 1 27 LYS n 1 28 ASN n 1 29 VAL n 1 30 SER n 1 31 GLN n 1 32 ALA n 1 33 ILE n 1 34 HIS n 1 35 LYS n 1 36 TYR n 1 37 ASN n 1 38 ALA n 1 39 TYR n 1 40 ARG n 1 41 LYS n 1 42 ALA n 1 43 ALA n 1 44 SER n 1 45 VAL n 1 46 ILE n 1 47 ALA n 1 48 LYS n 1 49 TYR n 1 50 PRO n 1 51 HIS n 1 52 LYS n 1 53 ILE n 1 54 LYS n 1 55 SER n 1 56 GLY n 1 57 ALA n 1 58 GLU n 1 59 ALA n 1 60 LYS n 1 61 LYS n 1 62 LEU n 1 63 PRO n 1 64 GLY n 1 65 VAL n 1 66 GLY n 1 67 THR n 1 68 LYS n 1 69 ILE n 1 70 ALA n 1 71 GLU n 1 72 LYS n 1 73 ILE n 1 74 ASP n 1 75 GLU n 1 76 PHE n 1 77 LEU n 1 78 ALA n 1 79 THR n 1 80 GLY n 1 81 LYS n 1 82 LEU n 1 83 ARG n 1 84 LYS n 1 85 LEU n 1 86 GLU n 1 87 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PRSET-8K _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DPOB_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P06766 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DK3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06766 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 87 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 5 2 2 3D_15N-SEPARATED_NOESY 2 3 1 3D_13C-SEPARATED_NOESY 4 4 1 HMQC-J 3 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 AMBIENT 6.7 400 ? K 2 298 AMBIENT 6.8 100 ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 ;2.8 MM RAT DNA POLYMERASE BETA N-TERMINAL DOMAIN (2-87) U-15N,13C; 5MM TRIS- D11; 400MM NACL ; ? 2 ;2 MM RAT DNA POLYMERASE BETA N-TERMINAL DOMAIN (2-87) U-15N; 5MM TRIS-D11; 100MM NACL ; ? 3 ;4 MM RAT DNA POLYMERASE BETA N-TERMINAL DOMAIN (2-87) U-15N; 5MM TRIS-D11; 400MM NACL ; ? 4 ;2.8 MM RAT DNA POLYMERASE BETA N-TERMINAL DOMAIN (2-87) U-15N,13C; 5MM TRIS- D11; 400MM NACL ; ? 5 ;1.4 MM RAT DNA POLYMERASE BETA N-TERMINAL DOMAIN (2-87); 5MM TRIS-D11; 400MM NACL ; ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 GN500 GE 500 ? 2 UNITYPLUS Varian 600 ? # _pdbx_nmr_refine.entry_id 1DK3 _pdbx_nmr_refine.method 'TORSION ANGLE DYNAMICS AND SIMULATED ANNEALING' _pdbx_nmr_refine.details ;THE NMR RESTRAINTS INCLUDED 921 USEFUL NOE DETERMINED UPPER DISTANCE RESTRAINTS, 41 HYDROGEN BONDS, AND 135 PHI AND CHI TORSION ANGLE RESTRAINTS. STRUCTURES WERE CALCULATED IN THE PROGRAM DYANA USING TORSION ANGLE DYNAMICS. THE CALCULATION STARTED WITH 100 RANDOMIZED STRUCTURES. THE 50 STRUCTURES WITH THE LOWEST TARGET FUNCTION WERE THEN REFINED WITHIN XPLOR USING SIMULATED ANNEALING. THE 25 LOWEST ENERGY STRUCTURAL CONFORMERS WERE SELECTED TO REPRESENT THE ENSEMBLE.THE 25 REFINED STRUCTURAL CONFORMERS DISPLAYED NO NOE VIOLATIONS >0.3 ANGSTROMS AND NO DIHEDRAL ANGLE VIOLATIONS >3 DEGREES. THE MINIMIZED AVERAGE STRUCTURE WAS CALCULATED FROM THE MEAN POSITION OF THE COORDINATES FOR THE 25 STRUCTURAL CONFORMERS AND WAS REFINED BY POWELL ENERGY MINIMIZATION IN XPLOR USING FULL NMR RESTRAINTS. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1DK3 _pdbx_nmr_details.text ;PROTEOLYTIC PROCESSING REMOVES THE N-TERMINAL MET IN A BACTERIAL EXPRESSION SYSTEM (SEE KUMAR ET AL., (1990) J. BIOL. CHEM. 265, 2124-2131). ; # _pdbx_nmr_ensemble.entry_id 1DK3 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1DK3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 4.3 VARIAN 1 processing Felix 95 'HARE, BIOSYM' 2 'data analysis' XEASY 1.3.13 BARTLES 3 'structure solution' DYANA 1.5 GUENTERT 4 refinement X-PLOR 4.0 BRUNGER 5 # _exptl.entry_id 1DK3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1DK3 _struct.title 'REFINED SOLUTION STRUCTURE OF THE N-TERMINAL DOMAIN OF DNA POLYMERASE BETA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1DK3 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;DNA-BINDING, DEOXYRIBOSE 5'-PHOSPHATE LYASE, NUCLEOTIDYLTRANSFERASE, TRANSFERASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 14 ? VAL A 29 ? GLY A 14 VAL A 29 1 ? 16 HELX_P HELX_P2 2 ILE A 33 ? LYS A 48 ? ILE A 33 LYS A 48 1 ? 16 HELX_P HELX_P3 3 SER A 55 ? LYS A 61 ? SER A 55 LYS A 61 1 ? 7 HELX_P HELX_P4 4 THR A 67 ? THR A 79 ? THR A 67 THR A 79 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1DK3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DK3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LYS 87 87 87 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-02-14 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 60.10 99.50 2 1 LYS A 3 ? ? 84.83 -40.85 3 1 LEU A 11 ? ? -89.60 -72.79 4 1 ASN A 12 ? ? -104.73 44.28 5 1 SER A 30 ? ? -77.27 -70.48 6 1 ALA A 32 ? ? -150.81 57.26 7 1 ALA A 78 ? ? -61.80 -79.46 8 1 ARG A 83 ? ? -63.43 -179.31 9 1 LYS A 84 ? ? -98.54 34.78 10 1 GLU A 86 ? ? -98.65 34.51 #