data_1DSJ # _entry.id 1DSJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DSJ pdb_00001dsj 10.2210/pdb1dsj/pdb WWPDB D_1000172923 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DSJ _pdbx_database_status.recvd_initial_deposition_date 1997-10-23 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yao, S.' 1 'Torres, A.M.' 2 'Azad, A.A.' 3 'Macreadie, I.G.' 4 'Norton, R.S.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Helical structure of polypeptides from the C-terminal half of HIV-1 VPR.' 'Protein Pept.Lett.' 5 127 134 1998 PPELEN NE 0929-8665 2077 ? -1 ? 1 'Vpr Protein of Human Immunodeficiency Virus Type 1 Forms Cation-Selective Channels in Planar Lipid Bilayers' Proc.Natl.Acad.Sci.USA 93 111 ? 1996 PNASA6 US 0027-8424 0040 ? ? ? 2 ;A Domain of Human Immunodeficiency Virus Type 1 Vpr Containing Repeated H(S/F)Rig Amino Acid Motifs Causes Cell Growth Arrest and Structural Defects ; Proc.Natl.Acad.Sci.USA 92 2770 ? 1995 PNASA6 US 0027-8424 0040 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yao, S.G.' 1 ? primary 'Azad, A.A.' 2 ? primary 'Macreadie, I.G.' 3 ? primary 'Norton, R.S.' 4 ? 1 'Piller, S.C.' 5 ? 1 'Ewart, G.D.' 6 ? 1 'Premkumar, A.' 7 ? 1 'Cox, G.B.' 8 ? 1 'Gage, P.W.' 9 ? 2 'Macreadie, I.G.' 10 ? 2 'Castelli, L.A.' 11 ? 2 'Hewish, D.R.' 12 ? 2 'Kirkpatrick, A.' 13 ? 2 'Ward, A.C.' 14 ? 2 'Azad, A.A.' 15 ? # _cell.entry_id 1DSJ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DSJ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'VPR PROTEIN' _entity.formula_weight 3057.594 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RESIDUES 50 - 75' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)YGDTWAGVEAIIRILQQLLFIHFRIG(NH2)' _entity_poly.pdbx_seq_one_letter_code_can XYGDTWAGVEAIIRILQQLLFIHFRIGX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 TYR n 1 3 GLY n 1 4 ASP n 1 5 THR n 1 6 TRP n 1 7 ALA n 1 8 GLY n 1 9 VAL n 1 10 GLU n 1 11 ALA n 1 12 ILE n 1 13 ILE n 1 14 ARG n 1 15 ILE n 1 16 LEU n 1 17 GLN n 1 18 GLN n 1 19 LEU n 1 20 LEU n 1 21 PHE n 1 22 ILE n 1 23 HIS n 1 24 PHE n 1 25 ARG n 1 26 ILE n 1 27 GLY n 1 28 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lentivirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VPR_HV1N5 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P12520 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRIWLHNLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSR IGVTRQRRARNGASRS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DSJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 27 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P12520 _struct_ref_seq.db_align_beg 50 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 75 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 50 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 3.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_ensemble.entry_id 1DSJ _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.1 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1DSJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1DSJ _struct.title 'NMR SOLUTION STRUCTURE OF VPR50_75, 20 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DSJ _struct_keywords.pdbx_keywords 'VIRAL PEPTIDE' _struct_keywords.text 'VIRAL PEPTIDE, POLYPEPTIDE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id A _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 5 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ILE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 26 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 53 _struct_conf.end_auth_comp_id ILE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 74 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details 'SEE REMARK 650' _struct_conf.pdbx_PDB_helix_length 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? A ? 1_555 A TYR 2 N ? ? A ACE 50 A TYR 50 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale2 covale both ? A GLY 27 C ? ? ? 1_555 A NH2 28 N ? ? A GLY 75 A NH2 76 1_555 ? ? ? ? ? ? ? 1.298 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1DSJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DSJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 50 50 ACE ACE A A n A 1 2 TYR 2 50 50 TYR TYR A . n A 1 3 GLY 3 51 51 GLY GLY A . n A 1 4 ASP 4 52 52 ASP ASP A . n A 1 5 THR 5 53 53 THR THR A . n A 1 6 TRP 6 54 54 TRP TRP A . n A 1 7 ALA 7 55 55 ALA ALA A . n A 1 8 GLY 8 56 56 GLY GLY A . n A 1 9 VAL 9 57 57 VAL VAL A . n A 1 10 GLU 10 58 58 GLU GLU A . n A 1 11 ALA 11 59 59 ALA ALA A . n A 1 12 ILE 12 60 60 ILE ILE A . n A 1 13 ILE 13 61 61 ILE ILE A . n A 1 14 ARG 14 62 62 ARG ARG A . n A 1 15 ILE 15 63 63 ILE ILE A . n A 1 16 LEU 16 64 64 LEU LEU A . n A 1 17 GLN 17 65 65 GLN GLN A . n A 1 18 GLN 18 66 66 GLN GLN A . n A 1 19 LEU 19 67 67 LEU LEU A . n A 1 20 LEU 20 68 68 LEU LEU A . n A 1 21 PHE 21 69 69 PHE PHE A . n A 1 22 ILE 22 70 70 ILE ILE A . n A 1 23 HIS 23 71 71 HIS HIS A . n A 1 24 PHE 24 72 72 PHE PHE A . n A 1 25 ARG 25 73 73 ARG ARG A . n A 1 26 ILE 26 74 74 ILE ILE A . n A 1 27 GLY 27 75 75 GLY GLY A . n A 1 28 NH2 28 76 76 NH2 NH2 A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-07-01 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.306 1.373 -0.067 0.011 N 2 2 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.306 1.373 -0.067 0.011 N 3 3 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.307 1.373 -0.066 0.011 N 4 4 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.306 1.373 -0.067 0.011 N 5 5 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.305 1.373 -0.068 0.011 N 6 6 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.305 1.373 -0.068 0.011 N 7 8 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.305 1.373 -0.068 0.011 N 8 9 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.307 1.373 -0.066 0.011 N 9 10 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.305 1.373 -0.068 0.011 N 10 12 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.306 1.373 -0.067 0.011 N 11 13 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.306 1.373 -0.067 0.011 N 12 14 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.307 1.373 -0.066 0.011 N 13 15 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.306 1.373 -0.067 0.011 N 14 16 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.306 1.373 -0.067 0.011 N 15 17 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.306 1.373 -0.067 0.011 N 16 18 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.306 1.373 -0.067 0.011 N 17 19 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.304 1.373 -0.069 0.011 N 18 20 NE2 A HIS 71 ? ? CD2 A HIS 71 ? ? 1.306 1.373 -0.067 0.011 N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 12 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 62 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 62 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 62 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 116.83 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.47 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 64 ? ? -76.44 -104.92 2 1 GLN A 65 ? ? -59.18 4.01 3 2 LEU A 64 ? ? -51.60 -79.59 4 3 LEU A 64 ? ? -47.76 -79.97 5 4 ASP A 52 ? ? 145.20 -38.61 6 4 LEU A 64 ? ? -48.67 -81.53 7 5 LEU A 64 ? ? -38.26 -89.76 8 6 LEU A 64 ? ? -55.30 -96.97 9 6 GLN A 65 ? ? -69.72 3.87 10 7 LEU A 64 ? ? -63.42 -73.29 11 8 LEU A 64 ? ? -44.66 -84.21 12 9 LEU A 64 ? ? -99.95 -90.15 13 10 ASP A 52 ? ? 140.37 -64.66 14 10 LEU A 64 ? ? -69.31 -102.55 15 10 GLN A 65 ? ? -64.13 1.03 16 11 ASP A 52 ? ? -142.15 -34.67 17 11 LEU A 64 ? ? -99.51 -96.79 18 12 LEU A 64 ? ? -95.26 -114.03 19 12 GLN A 65 ? ? -68.69 20.66 20 13 ASP A 52 ? ? -81.77 39.41 21 13 LEU A 64 ? ? -45.68 -87.02 22 14 LEU A 64 ? ? -57.21 -94.48 23 15 ASP A 52 ? ? -172.18 16.27 24 16 LEU A 64 ? ? -94.73 -99.18 25 16 GLN A 65 ? ? -65.67 0.02 26 17 TRP A 54 ? ? -49.37 -19.70 27 17 LEU A 64 ? ? -55.73 -75.96 28 18 LEU A 64 ? ? -85.56 -95.37 29 18 GLN A 65 ? ? -68.24 4.51 30 19 ASP A 52 ? ? -168.94 -10.56 31 19 LEU A 64 ? ? -58.64 -80.58 32 20 LEU A 64 ? ? -43.43 -75.46 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 62 ? ? 0.285 'SIDE CHAIN' 2 1 ARG A 73 ? ? 0.295 'SIDE CHAIN' 3 2 ARG A 62 ? ? 0.290 'SIDE CHAIN' 4 2 ARG A 73 ? ? 0.304 'SIDE CHAIN' 5 3 ARG A 62 ? ? 0.286 'SIDE CHAIN' 6 3 ARG A 73 ? ? 0.317 'SIDE CHAIN' 7 4 ARG A 62 ? ? 0.274 'SIDE CHAIN' 8 4 ARG A 73 ? ? 0.292 'SIDE CHAIN' 9 5 ARG A 62 ? ? 0.250 'SIDE CHAIN' 10 5 ARG A 73 ? ? 0.263 'SIDE CHAIN' 11 6 ARG A 62 ? ? 0.242 'SIDE CHAIN' 12 6 ARG A 73 ? ? 0.315 'SIDE CHAIN' 13 7 ARG A 62 ? ? 0.304 'SIDE CHAIN' 14 7 ARG A 73 ? ? 0.255 'SIDE CHAIN' 15 8 ARG A 62 ? ? 0.314 'SIDE CHAIN' 16 8 ARG A 73 ? ? 0.267 'SIDE CHAIN' 17 9 ARG A 62 ? ? 0.305 'SIDE CHAIN' 18 9 ARG A 73 ? ? 0.311 'SIDE CHAIN' 19 10 ARG A 62 ? ? 0.319 'SIDE CHAIN' 20 10 ARG A 73 ? ? 0.289 'SIDE CHAIN' 21 11 ARG A 62 ? ? 0.219 'SIDE CHAIN' 22 11 ARG A 73 ? ? 0.298 'SIDE CHAIN' 23 12 ARG A 62 ? ? 0.222 'SIDE CHAIN' 24 12 ARG A 73 ? ? 0.317 'SIDE CHAIN' 25 13 ARG A 62 ? ? 0.315 'SIDE CHAIN' 26 13 ARG A 73 ? ? 0.291 'SIDE CHAIN' 27 14 ARG A 62 ? ? 0.175 'SIDE CHAIN' 28 15 ARG A 62 ? ? 0.311 'SIDE CHAIN' 29 15 ARG A 73 ? ? 0.303 'SIDE CHAIN' 30 16 ARG A 62 ? ? 0.306 'SIDE CHAIN' 31 16 ARG A 73 ? ? 0.307 'SIDE CHAIN' 32 17 ARG A 62 ? ? 0.238 'SIDE CHAIN' 33 17 ARG A 73 ? ? 0.227 'SIDE CHAIN' 34 18 ARG A 62 ? ? 0.320 'SIDE CHAIN' 35 18 ARG A 73 ? ? 0.302 'SIDE CHAIN' 36 19 ARG A 62 ? ? 0.308 'SIDE CHAIN' 37 19 ARG A 73 ? ? 0.088 'SIDE CHAIN' 38 20 ARG A 62 ? ? 0.312 'SIDE CHAIN' 39 20 ARG A 73 ? ? 0.223 'SIDE CHAIN' #