data_1E0G # _entry.id 1E0G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1E0G PDBE EBI-4771 WWPDB D_1290004771 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2003-11-05 _pdbx_database_PDB_obs_spr.pdb_id 1E0G _pdbx_database_PDB_obs_spr.replace_pdb_id 1E01 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1E0G _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-03-27 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bateman, A.' 1 'Bycroft, M.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The Structure of a Lysm Domain from E.Coli Membrane Bound Lytic Murein Transglycosylase D (Mltd)' J.Mol.Biol. 299 1113 ? 2000 JMOBAK UK 0022-2836 0070 ? 10843862 10.1006/JMBI.2000.3778 1 ;Cloning, Molecular Characterization, and Expression of the Genes Encoding the Lytic Functions of Lactococcal Bacteriophage-Phi-Lc3; a Dual Lysis System of Modular Design ; Can.J.Microbiol. 40 658 ? 1994 ? ? 0008-4166 ? ? 7922887 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bateman, A.' 1 ? primary 'Bycroft, M.' 2 ? 1 'Birkeland, N.K.' 3 ? # _cell.entry_id 1E0G _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1E0G _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Membrane-bound lytic murein transglycosylase D' _entity.formula_weight 5442.219 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 4.2.2.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'LYSM DOMAIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DSITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVK _entity_poly.pdbx_seq_one_letter_code_can DSITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 SER n 1 3 ILE n 1 4 THR n 1 5 TYR n 1 6 ARG n 1 7 VAL n 1 8 ARG n 1 9 LYS n 1 10 GLY n 1 11 ASP n 1 12 SER n 1 13 LEU n 1 14 SER n 1 15 SER n 1 16 ILE n 1 17 ALA n 1 18 LYS n 1 19 ARG n 1 20 HIS n 1 21 GLY n 1 22 VAL n 1 23 ASN n 1 24 ILE n 1 25 LYS n 1 26 ASP n 1 27 VAL n 1 28 MET n 1 29 ARG n 1 30 TRP n 1 31 ASN n 1 32 SER n 1 33 ASP n 1 34 THR n 1 35 ALA n 1 36 ASN n 1 37 LEU n 1 38 GLN n 1 39 PRO n 1 40 GLY n 1 41 ASP n 1 42 LYS n 1 43 LEU n 1 44 THR n 1 45 LEU n 1 46 PHE n 1 47 VAL n 1 48 LYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 48 _pdbx_entity_src_syn.organism_scientific 'Escherichia coli' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 562 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A2Z2J5F1_ECOLX _struct_ref.pdbx_db_accession A0A2Z2J5F1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DSITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVK _struct_ref.pdbx_align_begin 352 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1E0G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 48 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A2Z2J5F1 _struct_ref_seq.db_align_beg 352 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 399 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 48 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1E0G _pdbx_nmr_refine.method SA _pdbx_nmr_refine.details 'SA FROM RANDOM COIL STARTING STRUCTURES' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1E0G _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 15N-LABELED MTLD LYSM DOMAIN' # _pdbx_nmr_ensemble.entry_id 1E0G _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR ? BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 1E0G _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1E0G _struct.title 'LYSM Domain from E.coli MLTD' _struct.pdbx_descriptor 'MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE D' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1E0G _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'CELL WALL, HYDROLASE, GLYCOSIDASE, LIPOPROTEIN, OUTER MEMBRANE, MULTIGENE FAMILY' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 12 ? HIS A 20 ? SER A 12 HIS A 20 1 ? 9 HELX_P HELX_P2 2 ASN A 23 ? ASN A 31 ? ASN A 23 ASN A 31 1 ? 9 HELX_P HELX_P3 3 ASP A 33 ? LEU A 37 ? ASP A 33 LEU A 37 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 4 ? VAL A 7 ? THR A 4 VAL A 7 A 2 ASP A 41 ? THR A 44 ? ASP A 41 THR A 44 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 5 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 5 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 43 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 43 # _database_PDB_matrix.entry_id 1E0G _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1E0G _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LYS 48 48 48 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-06-21 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-09-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 4 'Structure model' 'Source and taxonomy' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity 2 4 'Structure model' entity_name_com 3 4 'Structure model' pdbx_database_status 4 4 'Structure model' pdbx_entity_src_syn 5 4 'Structure model' pdbx_nmr_software 6 4 'Structure model' struct_ref 7 4 'Structure model' struct_ref_seq # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity.pdbx_description' 2 4 'Structure model' '_entity.pdbx_ec' 3 4 'Structure model' '_pdbx_database_status.status_code_mr' 4 4 'Structure model' '_pdbx_entity_src_syn.organism_scientific' 5 4 'Structure model' '_pdbx_entity_src_syn.pdbx_beg_seq_num' 6 4 'Structure model' '_pdbx_entity_src_syn.pdbx_end_seq_num' 7 4 'Structure model' '_pdbx_nmr_software.name' 8 4 'Structure model' '_struct_ref.db_code' 9 4 'Structure model' '_struct_ref.pdbx_align_begin' 10 4 'Structure model' '_struct_ref.pdbx_db_accession' 11 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 12 4 'Structure model' '_struct_ref_seq.db_align_beg' 13 4 'Structure model' '_struct_ref_seq.db_align_end' 14 4 'Structure model' '_struct_ref_seq.pdbx_db_accession' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 39 ? ? -69.01 86.75 2 1 LEU A 45 ? ? -117.02 55.32 3 1 VAL A 47 ? ? -39.57 143.39 4 2 PRO A 39 ? ? -68.84 84.53 5 2 LEU A 45 ? ? -115.05 55.09 6 2 VAL A 47 ? ? -39.43 141.57 7 3 SER A 32 ? ? -89.68 -82.69 8 3 THR A 34 ? ? -88.20 42.36 9 3 PRO A 39 ? ? -68.45 86.30 10 3 LEU A 45 ? ? -110.62 55.13 11 3 VAL A 47 ? ? -39.64 144.65 12 4 THR A 34 ? ? -86.97 32.61 13 4 PRO A 39 ? ? -68.69 85.99 14 4 LEU A 45 ? ? -109.02 55.53 15 4 VAL A 47 ? ? -37.94 142.87 16 5 PRO A 39 ? ? -69.08 85.04 17 5 VAL A 47 ? ? -39.59 139.04 18 6 SER A 32 ? ? -87.04 -81.92 19 6 THR A 34 ? ? -89.82 43.78 20 6 PRO A 39 ? ? -69.44 86.19 21 6 VAL A 47 ? ? -39.40 140.06 22 7 SER A 32 ? ? -93.13 -82.83 23 7 THR A 34 ? ? -84.37 48.39 24 7 PRO A 39 ? ? -68.91 86.83 25 7 LEU A 45 ? ? -110.78 55.20 26 7 VAL A 47 ? ? -38.94 142.88 27 8 THR A 34 ? ? -89.13 32.48 28 8 PRO A 39 ? ? -69.10 84.73 29 8 VAL A 47 ? ? -37.21 138.15 30 9 THR A 34 ? ? -86.99 41.08 31 9 PRO A 39 ? ? -69.32 84.29 32 9 VAL A 47 ? ? -38.24 143.12 33 10 SER A 32 ? ? -92.31 -82.12 34 10 THR A 34 ? ? -87.12 41.64 35 10 PRO A 39 ? ? -69.87 86.39 36 10 LEU A 45 ? ? -117.73 54.52 37 10 VAL A 47 ? ? -38.39 137.30 38 11 SER A 32 ? ? -91.00 -81.32 39 11 THR A 34 ? ? -86.22 41.08 40 11 PRO A 39 ? ? -68.98 85.59 41 11 LEU A 45 ? ? -115.02 54.00 42 11 VAL A 47 ? ? -38.53 137.46 43 12 PRO A 39 ? ? -69.29 85.82 44 13 SER A 32 ? ? -92.45 -78.72 45 13 THR A 34 ? ? -84.84 47.06 46 13 PRO A 39 ? ? -69.86 85.90 47 13 LEU A 45 ? ? -118.38 54.53 48 13 VAL A 47 ? ? -39.00 137.49 49 14 SER A 32 ? ? -94.42 -82.53 50 14 THR A 34 ? ? -84.29 47.57 51 14 PRO A 39 ? ? -69.08 85.24 52 14 LEU A 45 ? ? -116.70 54.59 53 15 SER A 32 ? ? -92.68 -83.03 54 15 THR A 34 ? ? -83.39 48.05 55 15 PRO A 39 ? ? -68.86 87.40 56 15 LEU A 45 ? ? -113.91 56.43 57 16 SER A 32 ? ? -88.39 -81.95 58 16 THR A 34 ? ? -86.17 43.36 59 16 PRO A 39 ? ? -67.82 86.64 60 16 LEU A 45 ? ? -111.67 54.78 61 17 SER A 32 ? ? -97.29 -80.98 62 17 ASP A 33 ? ? -69.58 94.14 63 17 THR A 34 ? ? -87.28 49.43 64 17 PRO A 39 ? ? -69.05 84.52 65 17 LEU A 45 ? ? -117.20 55.49 66 17 VAL A 47 ? ? -39.36 140.28 67 18 PRO A 39 ? ? -69.06 85.55 68 18 VAL A 47 ? ? -38.97 138.95 69 19 SER A 32 ? ? -98.69 -78.31 70 19 ASP A 33 ? ? -68.08 92.52 71 19 THR A 34 ? ? -83.57 49.43 72 19 PRO A 39 ? ? -69.28 85.44 73 19 LEU A 45 ? ? -117.65 54.37 74 19 VAL A 47 ? ? -39.17 138.80 75 20 PRO A 39 ? ? -69.22 86.61 76 20 VAL A 47 ? ? -37.61 141.09 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 6 ? ? 0.294 'SIDE CHAIN' 2 1 ARG A 8 ? ? 0.301 'SIDE CHAIN' 3 1 ARG A 19 ? ? 0.308 'SIDE CHAIN' 4 1 ARG A 29 ? ? 0.296 'SIDE CHAIN' 5 2 ARG A 6 ? ? 0.291 'SIDE CHAIN' 6 2 ARG A 8 ? ? 0.293 'SIDE CHAIN' 7 2 ARG A 19 ? ? 0.129 'SIDE CHAIN' 8 2 ARG A 29 ? ? 0.259 'SIDE CHAIN' 9 3 ARG A 6 ? ? 0.307 'SIDE CHAIN' 10 3 ARG A 8 ? ? 0.317 'SIDE CHAIN' 11 3 ARG A 19 ? ? 0.135 'SIDE CHAIN' 12 3 ARG A 29 ? ? 0.262 'SIDE CHAIN' 13 4 ARG A 6 ? ? 0.318 'SIDE CHAIN' 14 4 ARG A 8 ? ? 0.235 'SIDE CHAIN' 15 4 ARG A 19 ? ? 0.264 'SIDE CHAIN' 16 4 ARG A 29 ? ? 0.312 'SIDE CHAIN' 17 5 ARG A 6 ? ? 0.317 'SIDE CHAIN' 18 5 ARG A 8 ? ? 0.273 'SIDE CHAIN' 19 5 ARG A 19 ? ? 0.237 'SIDE CHAIN' 20 5 ARG A 29 ? ? 0.276 'SIDE CHAIN' 21 6 ARG A 6 ? ? 0.315 'SIDE CHAIN' 22 6 ARG A 8 ? ? 0.315 'SIDE CHAIN' 23 6 ARG A 19 ? ? 0.248 'SIDE CHAIN' 24 6 ARG A 29 ? ? 0.310 'SIDE CHAIN' 25 7 ARG A 6 ? ? 0.264 'SIDE CHAIN' 26 7 ARG A 8 ? ? 0.220 'SIDE CHAIN' 27 7 ARG A 19 ? ? 0.215 'SIDE CHAIN' 28 7 ARG A 29 ? ? 0.229 'SIDE CHAIN' 29 8 ARG A 6 ? ? 0.249 'SIDE CHAIN' 30 8 ARG A 8 ? ? 0.309 'SIDE CHAIN' 31 8 ARG A 19 ? ? 0.284 'SIDE CHAIN' 32 8 ARG A 29 ? ? 0.239 'SIDE CHAIN' 33 9 ARG A 6 ? ? 0.300 'SIDE CHAIN' 34 9 ARG A 8 ? ? 0.277 'SIDE CHAIN' 35 9 ARG A 19 ? ? 0.251 'SIDE CHAIN' 36 9 ARG A 29 ? ? 0.289 'SIDE CHAIN' 37 10 ARG A 6 ? ? 0.287 'SIDE CHAIN' 38 10 ARG A 8 ? ? 0.303 'SIDE CHAIN' 39 10 ARG A 19 ? ? 0.297 'SIDE CHAIN' 40 10 ARG A 29 ? ? 0.227 'SIDE CHAIN' 41 11 ARG A 6 ? ? 0.221 'SIDE CHAIN' 42 11 ARG A 8 ? ? 0.186 'SIDE CHAIN' 43 11 ARG A 19 ? ? 0.210 'SIDE CHAIN' 44 11 ARG A 29 ? ? 0.316 'SIDE CHAIN' 45 12 ARG A 6 ? ? 0.259 'SIDE CHAIN' 46 12 ARG A 8 ? ? 0.306 'SIDE CHAIN' 47 12 ARG A 19 ? ? 0.230 'SIDE CHAIN' 48 12 ARG A 29 ? ? 0.241 'SIDE CHAIN' 49 13 ARG A 6 ? ? 0.230 'SIDE CHAIN' 50 13 ARG A 8 ? ? 0.317 'SIDE CHAIN' 51 13 ARG A 19 ? ? 0.108 'SIDE CHAIN' 52 13 ARG A 29 ? ? 0.300 'SIDE CHAIN' 53 14 ARG A 6 ? ? 0.275 'SIDE CHAIN' 54 14 ARG A 8 ? ? 0.310 'SIDE CHAIN' 55 14 ARG A 19 ? ? 0.304 'SIDE CHAIN' 56 14 ARG A 29 ? ? 0.212 'SIDE CHAIN' 57 15 ARG A 6 ? ? 0.218 'SIDE CHAIN' 58 15 ARG A 8 ? ? 0.242 'SIDE CHAIN' 59 15 ARG A 19 ? ? 0.279 'SIDE CHAIN' 60 15 ARG A 29 ? ? 0.307 'SIDE CHAIN' 61 16 ARG A 6 ? ? 0.307 'SIDE CHAIN' 62 16 ARG A 8 ? ? 0.288 'SIDE CHAIN' 63 16 ARG A 19 ? ? 0.280 'SIDE CHAIN' 64 16 ARG A 29 ? ? 0.214 'SIDE CHAIN' 65 17 ARG A 6 ? ? 0.148 'SIDE CHAIN' 66 17 ARG A 8 ? ? 0.312 'SIDE CHAIN' 67 17 ARG A 19 ? ? 0.281 'SIDE CHAIN' 68 17 ARG A 29 ? ? 0.293 'SIDE CHAIN' 69 18 ARG A 6 ? ? 0.254 'SIDE CHAIN' 70 18 ARG A 8 ? ? 0.110 'SIDE CHAIN' 71 18 ARG A 19 ? ? 0.118 'SIDE CHAIN' 72 18 ARG A 29 ? ? 0.316 'SIDE CHAIN' 73 19 ARG A 6 ? ? 0.316 'SIDE CHAIN' 74 19 ARG A 8 ? ? 0.222 'SIDE CHAIN' 75 19 ARG A 19 ? ? 0.259 'SIDE CHAIN' 76 19 ARG A 29 ? ? 0.281 'SIDE CHAIN' 77 20 ARG A 6 ? ? 0.203 'SIDE CHAIN' 78 20 ARG A 8 ? ? 0.304 'SIDE CHAIN' 79 20 ARG A 19 ? ? 0.289 'SIDE CHAIN' 80 20 ARG A 29 ? ? 0.228 'SIDE CHAIN' #