data_1ELA # _entry.id 1ELA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1ELA WWPDB D_1000173061 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1ELB . unspecified PDB 1ELC . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ELA _pdbx_database_status.recvd_initial_deposition_date 1993-12-07 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mattos, C.' 1 'Rasmussen, B.' 2 'Ding, X.' 3 'Petsko, G.A.' 4 'Ringe, D.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Analogous inhibitors of elastase do not always bind analogously.' Nat.Struct.Biol. 1 55 58 1994 NSBIEW US 1072-8368 2024 ? 7656008 10.1038/nsb0194-55 1 'Interaction of the Peptide Cf3-Leu-Ala-Nh-C6H4-Cf3 (Tfla) with Porcine Pancreatic Elastase. X-Ray Studies at 1.8 Angstroms' J.Mol.Recog. 3 36 ? 1990 JMORE4 UK 0952-3499 0814 ? ? ? 2 'Structure of Native Porcine Pancreatic Elastase at 1.65 Angstroms Resolution' 'Acta Crystallogr.,Sect.B' 44 26 ? 1988 ASBSDK DK 0108-7681 0622 ? ? ? 3 'Structure of the Product Complex of Acetyl-Ala-Pro-Ala with Porcine Pancreatic Elastase at 1.65 Angstroms Resolution' J.Mol.Biol. 189 533 ? 1986 JMOBAK UK 0022-2836 0070 ? ? ? 4 'Crystallographic Study of the Binding of a Tri-Fluoroacetyl Dipeptide Anilide Inhibitor with Elastase' J.Mol.Biol. 162 645 ? 1982 JMOBAK UK 0022-2836 0070 ? ? ? 5 'The Indirect Mechanism of Action of the Trifluoroacetyl Peptides on Elastase' Eur.J.Biochem. 107 423 ? 1980 EJBCAI IX 0014-2956 0262 ? ? ? 6 ;The Atomic Structure of Crystalline Porcine Pancreatic Elastase at 2.5 Angstroms Resolution. Comparisons with the Structure of Alpha-Chymotrypsin ; J.Mol.Biol. 118 137 ? 1978 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Mattos, C.' 1 primary 'Rasmussen, B.' 2 primary 'Ding, X.' 3 primary 'Petsko, G.A.' 4 primary 'Ringe, D.' 5 1 'Li De La Sierra, I.' 6 1 'Papamichael, E.' 7 1 'Sakarelos, C.' 8 1 'Dimicoli, J.-L.' 9 1 'Prange, T.' 10 2 'Meyer, E.' 11 2 'Cole, G.' 12 2 'Radhakrishnan, R.' 13 2 'Epp, O.' 14 3 'Meyer, E.' 15 3 'Radhakrishnan, R.' 16 3 'Cole, G.' 17 3 'Presta, L.G.' 18 4 'Hughes, D.L.' 19 4 'Diecker, L.C.' 20 4 'Bieth, L.C.' 21 4 'Dimicoli, J.-L.' 22 5 'Dimicoli, J.-L.' 23 5 'Renaud, A.' 24 5 'Bieth, J.' 25 6 'Sawyer, L.' 26 6 'Shotton, C.M.' 27 6 'Campbell, J.W.' 28 6 'Wendell, P.L.' 29 6 'Muirhead, H.' 30 6 'Watson, H.C.' 31 6 'Diamond, R.' 32 6 'Ladner, R.C.' 33 # _cell.entry_id 1ELA _cell.length_a 52.370 _cell.length_b 57.710 _cell.length_c 75.430 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ELA _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ELASTASE 25928.031 1 3.4.21.36 ? ? ? 2 non-polymer syn '6-ammonio-N-(trifluoroacetyl)-L-norleucyl-N-[4-(1-methylethyl)phenyl]-L-prolinamide' 457.510 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 non-polymer syn 'ACETIC ACID' 60.052 1 ? ? ? ? 6 water nat water 18.015 166 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVH PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN ; _entity_poly.pdbx_seq_one_letter_code_can ;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVH PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 THR n 1 6 GLU n 1 7 ALA n 1 8 GLN n 1 9 ARG n 1 10 ASN n 1 11 SER n 1 12 TRP n 1 13 PRO n 1 14 SER n 1 15 GLN n 1 16 ILE n 1 17 SER n 1 18 LEU n 1 19 GLN n 1 20 TYR n 1 21 ARG n 1 22 SER n 1 23 GLY n 1 24 SER n 1 25 SER n 1 26 TRP n 1 27 ALA n 1 28 HIS n 1 29 THR n 1 30 CYS n 1 31 GLY n 1 32 GLY n 1 33 THR n 1 34 LEU n 1 35 ILE n 1 36 ARG n 1 37 GLN n 1 38 ASN n 1 39 TRP n 1 40 VAL n 1 41 MET n 1 42 THR n 1 43 ALA n 1 44 ALA n 1 45 HIS n 1 46 CYS n 1 47 VAL n 1 48 ASP n 1 49 ARG n 1 50 GLU n 1 51 LEU n 1 52 THR n 1 53 PHE n 1 54 ARG n 1 55 VAL n 1 56 VAL n 1 57 VAL n 1 58 GLY n 1 59 GLU n 1 60 HIS n 1 61 ASN n 1 62 LEU n 1 63 ASN n 1 64 GLN n 1 65 ASN n 1 66 ASN n 1 67 GLY n 1 68 THR n 1 69 GLU n 1 70 GLN n 1 71 TYR n 1 72 VAL n 1 73 GLY n 1 74 VAL n 1 75 GLN n 1 76 LYS n 1 77 ILE n 1 78 VAL n 1 79 VAL n 1 80 HIS n 1 81 PRO n 1 82 TYR n 1 83 TRP n 1 84 ASN n 1 85 THR n 1 86 ASP n 1 87 ASP n 1 88 VAL n 1 89 ALA n 1 90 ALA n 1 91 GLY n 1 92 TYR n 1 93 ASP n 1 94 ILE n 1 95 ALA n 1 96 LEU n 1 97 LEU n 1 98 ARG n 1 99 LEU n 1 100 ALA n 1 101 GLN n 1 102 SER n 1 103 VAL n 1 104 THR n 1 105 LEU n 1 106 ASN n 1 107 SER n 1 108 TYR n 1 109 VAL n 1 110 GLN n 1 111 LEU n 1 112 GLY n 1 113 VAL n 1 114 LEU n 1 115 PRO n 1 116 ARG n 1 117 ALA n 1 118 GLY n 1 119 THR n 1 120 ILE n 1 121 LEU n 1 122 ALA n 1 123 ASN n 1 124 ASN n 1 125 SER n 1 126 PRO n 1 127 CYS n 1 128 TYR n 1 129 ILE n 1 130 THR n 1 131 GLY n 1 132 TRP n 1 133 GLY n 1 134 LEU n 1 135 THR n 1 136 ARG n 1 137 THR n 1 138 ASN n 1 139 GLY n 1 140 GLN n 1 141 LEU n 1 142 ALA n 1 143 GLN n 1 144 THR n 1 145 LEU n 1 146 GLN n 1 147 GLN n 1 148 ALA n 1 149 TYR n 1 150 LEU n 1 151 PRO n 1 152 THR n 1 153 VAL n 1 154 ASP n 1 155 TYR n 1 156 ALA n 1 157 ILE n 1 158 CYS n 1 159 SER n 1 160 SER n 1 161 SER n 1 162 SER n 1 163 TYR n 1 164 TRP n 1 165 GLY n 1 166 SER n 1 167 THR n 1 168 VAL n 1 169 LYS n 1 170 ASN n 1 171 SER n 1 172 MET n 1 173 VAL n 1 174 CYS n 1 175 ALA n 1 176 GLY n 1 177 GLY n 1 178 ASP n 1 179 GLY n 1 180 VAL n 1 181 ARG n 1 182 SER n 1 183 GLY n 1 184 CYS n 1 185 GLN n 1 186 GLY n 1 187 ASP n 1 188 SER n 1 189 GLY n 1 190 GLY n 1 191 PRO n 1 192 LEU n 1 193 HIS n 1 194 CYS n 1 195 LEU n 1 196 VAL n 1 197 ASN n 1 198 GLY n 1 199 GLN n 1 200 TYR n 1 201 ALA n 1 202 VAL n 1 203 HIS n 1 204 GLY n 1 205 VAL n 1 206 THR n 1 207 SER n 1 208 PHE n 1 209 VAL n 1 210 SER n 1 211 ARG n 1 212 LEU n 1 213 GLY n 1 214 CYS n 1 215 ASN n 1 216 VAL n 1 217 THR n 1 218 ARG n 1 219 LYS n 1 220 PRO n 1 221 THR n 1 222 VAL n 1 223 PHE n 1 224 THR n 1 225 ARG n 1 226 VAL n 1 227 SER n 1 228 ALA n 1 229 TYR n 1 230 ILE n 1 231 SER n 1 232 TRP n 1 233 ILE n 1 234 ASN n 1 235 ASN n 1 236 VAL n 1 237 ILE n 1 238 ALA n 1 239 SER n 1 240 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name pig _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sus scrofa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ PANCREAS _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EL1_PIG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00772 _struct_ref.pdbx_align_begin 27 _struct_ref.pdbx_seq_one_letter_code ;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVH PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ELA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00772 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 266 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 255 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1ELA _struct_ref_seq_dif.mon_id ASN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 66 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00772 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 92 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 81 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0Z1 peptide-like . '6-ammonio-N-(trifluoroacetyl)-L-norleucyl-N-[4-(1-methylethyl)phenyl]-L-prolinamide' ? 'C22 H32 F3 N4 O3 1' 457.510 ACY non-polymer . 'ACETIC ACID' ? 'C2 H4 O2' 60.052 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1ELA _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.16 _exptl_crystal.density_percent_sol 43.04 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;THE COMPLEX WAS CO-CRYSTALLIZED. THE CO-CRYSTALS WERE GROWN BY THE METHOD OF VAPOR DIFFUSION IN 40 MICROLITER DROPS CONTAINING 7MG/ML OF ELASTASE, 0.1 MILLIMOLAR TFA-LYS-PRO-ISO, 1.4 MILLIMOLAR SODIUM SULFATE AND 100 MILLIMOLAR ACETATE BUFFER AT PH 5. ; # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1ELA _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10. _refine.ls_d_res_high 2. _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.185 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.185 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1822 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.number_atoms_solvent 166 _refine_hist.number_atoms_total 2030 _refine_hist.d_res_high 2. _refine_hist.d_res_low 10. # _struct.entry_id 1ELA _struct.title 'Analogous inhibitors of elastase do not always bind analogously' _struct.pdbx_descriptor 'ELASTASE (E.C.3.4.21.36) COMPLEXED WITH TRIFLUOROACETYL-L-LYSYL-L-PROLYL-P-ISOPROPYLANILIDE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ELA _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' _struct_keywords.text 'HYDROLASE-HYDROLASE INHIBITOR COMPLEX, SERINE PROTEINASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 ASP A 154 ? SER A 160 ? ASP A 169 SER A 175 1 ? 7 HELX_P HELX_P2 H2 TYR A 229 ? ASN A 240 ? TYR A 244 ASN A 255 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 45 A CYS 61 1_555 ? ? ? ? ? ? ? 2.032 ? disulf2 disulf ? ? A CYS 127 SG ? ? ? 1_555 A CYS 194 SG ? ? A CYS 142 A CYS 209 1_555 ? ? ? ? ? ? ? 1.992 ? disulf3 disulf ? ? A CYS 158 SG ? ? ? 1_555 A CYS 174 SG ? ? A CYS 173 A CYS 189 1_555 ? ? ? ? ? ? ? 1.980 ? disulf4 disulf ? ? A CYS 184 SG ? ? ? 1_555 A CYS 214 SG ? ? A CYS 199 A CYS 229 1_555 ? ? ? ? ? ? ? 2.009 ? metalc1 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 59 OE2 ? ? A CA 280 A GLU 74 1_555 ? ? ? ? ? ? ? 3.243 ? metalc2 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 69 OE2 ? ? A CA 280 A GLU 84 1_555 ? ? ? ? ? ? ? 2.510 ? metalc3 metalc ? ? C CA . CA ? ? ? 1_555 A GLN 64 O ? ? A CA 280 A GLN 79 1_555 ? ? ? ? ? ? ? 2.420 ? metalc4 metalc ? ? C CA . CA ? ? ? 1_555 A ASN 61 O ? ? A CA 280 A ASN 76 1_555 ? ? ? ? ? ? ? 2.382 ? metalc5 metalc ? ? C CA . CA ? ? ? 1_555 A ASN 66 OD1 ? ? A CA 280 A ASN 81 1_555 ? ? ? ? ? ? ? 2.592 ? metalc6 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 59 OE1 ? ? A CA 280 A GLU 74 1_555 ? ? ? ? ? ? ? 2.516 ? metalc7 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 280 A HOH 607 1_555 ? ? ? ? ? ? ? 2.425 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 7 ? S2 ? 7 ? S3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel S1 3 4 ? anti-parallel S1 4 5 ? anti-parallel S1 5 6 ? anti-parallel S1 6 7 ? anti-parallel S2 1 2 ? anti-parallel S2 2 3 ? anti-parallel S2 3 4 ? anti-parallel S2 4 5 ? anti-parallel S2 5 6 ? anti-parallel S2 6 7 ? anti-parallel S3 1 2 ? anti-parallel S3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 SER A 14 ? SER A 22 ? SER A 29 SER A 37 S1 2 SER A 25 ? ILE A 35 ? SER A 40 ILE A 50 S1 3 ASN A 38 ? ALA A 44 ? ASN A 53 ALA A 59 S1 4 ASP A 93 ? GLN A 101 ? ASP A 108 GLN A 116 S1 5 GLU A 69 ? HIS A 80 ? GLU A 84 HIS A 95 S1 6 PHE A 53 ? GLY A 58 ? PHE A 68 GLY A 73 S1 7 SER A 14 ? SER A 22 ? SER A 29 SER A 37 S2 1 ASN A 124 ? THR A 135 ? ASN A 139 THR A 150 S2 2 GLY A 139 ? VAL A 153 ? GLY A 154 VAL A 168 S2 3 SER A 171 ? VAL A 180 ? SER A 186 VAL A 195 S2 4 ASN A 215 ? VAL A 226 ? ASN A 230 VAL A 241 S2 5 HIS A 203 ? VAL A 209 ? HIS A 218 VAL A 224 S2 6 SER A 188 ? CYS A 194 ? SER A 203 CYS A 209 S2 7 SER A 125 ? THR A 135 ? SER A 140 THR A 150 S3 1 GLY A 139 ? ALA A 142 ? GLY A 154 ALA A 157 S3 2 TRP A 132 ? LEU A 134 ? TRP A 147 LEU A 149 S3 3 GLN A 185 ? ASP A 187 ? GLN A 200 ASP A 202 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 0Z1 A 256' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 280' AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 290' AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE ACY A 300' CAT Author ? ? ? ? 3 'CATALYTIC TRIAD' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 HIS A 45 ? HIS A 60 . ? 1_555 ? 2 AC1 14 GLU A 50 ? GLU A 65 . ? 4_456 ? 3 AC1 14 LEU A 51 ? LEU A 66 . ? 4_456 ? 4 AC1 14 THR A 52 ? THR A 67 . ? 4_456 ? 5 AC1 14 CYS A 184 ? CYS A 199 . ? 1_555 ? 6 AC1 14 GLN A 185 ? GLN A 200 . ? 1_555 ? 7 AC1 14 SER A 188 ? SER A 203 . ? 1_555 ? 8 AC1 14 THR A 206 ? THR A 221 . ? 1_555 ? 9 AC1 14 SER A 207 ? SER A 222 . ? 1_555 ? 10 AC1 14 PHE A 208 ? PHE A 223 . ? 1_555 ? 11 AC1 14 VAL A 209 ? VAL A 224 . ? 1_555 ? 12 AC1 14 ACY E . ? ACY A 300 . ? 1_555 ? 13 AC1 14 HOH F . ? HOH A 542 . ? 1_555 ? 14 AC1 14 HOH F . ? HOH A 706 . ? 1_555 ? 15 AC2 6 GLU A 59 ? GLU A 74 . ? 1_555 ? 16 AC2 6 ASN A 61 ? ASN A 76 . ? 1_555 ? 17 AC2 6 GLN A 64 ? GLN A 79 . ? 1_555 ? 18 AC2 6 ASN A 66 ? ASN A 81 . ? 1_555 ? 19 AC2 6 GLU A 69 ? GLU A 84 . ? 1_555 ? 20 AC2 6 HOH F . ? HOH A 607 . ? 1_555 ? 21 AC3 7 GLY A 118 ? GLY A 133 . ? 1_555 ? 22 AC3 7 ARG A 136 ? ARG A 151 . ? 2_665 ? 23 AC3 7 ARG A 225 ? ARG A 240 . ? 1_555 ? 24 AC3 7 SER A 227 ? SER A 242 . ? 1_555 ? 25 AC3 7 ALA A 228 ? ALA A 243 . ? 1_555 ? 26 AC3 7 HOH F . ? HOH A 432 . ? 1_555 ? 27 AC3 7 HOH F . ? HOH A 451 . ? 1_555 ? 28 AC4 7 THR A 29 ? THR A 44 . ? 1_555 ? 29 AC4 7 HIS A 45 ? HIS A 60 . ? 1_555 ? 30 AC4 7 GLN A 185 ? GLN A 200 . ? 1_555 ? 31 AC4 7 GLY A 186 ? GLY A 201 . ? 1_555 ? 32 AC4 7 SER A 188 ? SER A 203 . ? 1_555 ? 33 AC4 7 0Z1 B . ? 0Z1 A 256 . ? 1_555 ? 34 AC4 7 HOH F . ? HOH A 679 . ? 1_555 ? 35 CAT 3 ASP A 93 ? ASP A 108 . ? 1_555 ? 36 CAT 3 HIS A 45 ? HIS A 60 . ? 1_555 ? 37 CAT 3 SER A 188 ? SER A 203 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ELA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ELA _atom_sites.fract_transf_matrix[1][1] 0.019095 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017328 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013257 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 16 16 VAL VAL A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 THR 5 20 20 THR THR A . n A 1 6 GLU 6 21 21 GLU GLU A . n A 1 7 ALA 7 22 22 ALA ALA A . n A 1 8 GLN 8 23 23 GLN GLN A . n A 1 9 ARG 9 24 24 ARG ARG A . n A 1 10 ASN 10 25 25 ASN ASN A . n A 1 11 SER 11 26 26 SER SER A . n A 1 12 TRP 12 27 27 TRP TRP A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 SER 14 29 29 SER SER A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 ILE 16 31 31 ILE ILE A . n A 1 17 SER 17 32 32 SER SER A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 GLN 19 34 34 GLN GLN A . n A 1 20 TYR 20 35 35 TYR TYR A . n A 1 21 ARG 21 36 36 ARG ARG A . n A 1 22 SER 22 37 37 SER SER A . n A 1 23 GLY 23 38 38 GLY GLY A . n A 1 24 SER 24 39 39 SER SER A . n A 1 25 SER 25 40 40 SER SER A . n A 1 26 TRP 26 41 41 TRP TRP A . n A 1 27 ALA 27 42 42 ALA ALA A . n A 1 28 HIS 28 43 43 HIS HIS A . n A 1 29 THR 29 44 44 THR THR A . n A 1 30 CYS 30 45 45 CYS CYS A . n A 1 31 GLY 31 46 46 GLY GLY A . n A 1 32 GLY 32 47 47 GLY GLY A . n A 1 33 THR 33 48 48 THR THR A . n A 1 34 LEU 34 49 49 LEU LEU A . n A 1 35 ILE 35 50 50 ILE ILE A . n A 1 36 ARG 36 51 51 ARG ARG A . n A 1 37 GLN 37 52 52 GLN GLN A . n A 1 38 ASN 38 53 53 ASN ASN A . n A 1 39 TRP 39 54 54 TRP TRP A . n A 1 40 VAL 40 55 55 VAL VAL A . n A 1 41 MET 41 56 56 MET MET A . n A 1 42 THR 42 57 57 THR THR A . n A 1 43 ALA 43 58 58 ALA ALA A . n A 1 44 ALA 44 59 59 ALA ALA A . n A 1 45 HIS 45 60 60 HIS HIS A . n A 1 46 CYS 46 61 61 CYS CYS A . n A 1 47 VAL 47 62 62 VAL VAL A . n A 1 48 ASP 48 63 63 ASP ASP A . n A 1 49 ARG 49 64 64 ARG ARG A . n A 1 50 GLU 50 65 65 GLU GLU A . n A 1 51 LEU 51 66 66 LEU LEU A . n A 1 52 THR 52 67 67 THR THR A . n A 1 53 PHE 53 68 68 PHE PHE A . n A 1 54 ARG 54 69 69 ARG ARG A . n A 1 55 VAL 55 70 70 VAL VAL A . n A 1 56 VAL 56 71 71 VAL VAL A . n A 1 57 VAL 57 72 72 VAL VAL A . n A 1 58 GLY 58 73 73 GLY GLY A . n A 1 59 GLU 59 74 74 GLU GLU A . n A 1 60 HIS 60 75 75 HIS HIS A . n A 1 61 ASN 61 76 76 ASN ASN A . n A 1 62 LEU 62 77 77 LEU LEU A . n A 1 63 ASN 63 78 78 ASN ASN A . n A 1 64 GLN 64 79 79 GLN GLN A . n A 1 65 ASN 65 80 80 ASN ASN A . n A 1 66 ASN 66 81 81 ASN ASN A . n A 1 67 GLY 67 82 82 GLY GLY A . n A 1 68 THR 68 83 83 THR THR A . n A 1 69 GLU 69 84 84 GLU GLU A . n A 1 70 GLN 70 85 85 GLN GLN A . n A 1 71 TYR 71 86 86 TYR TYR A . n A 1 72 VAL 72 87 87 VAL VAL A . n A 1 73 GLY 73 88 88 GLY GLY A . n A 1 74 VAL 74 89 89 VAL VAL A . n A 1 75 GLN 75 90 90 GLN GLN A . n A 1 76 LYS 76 91 91 LYS LYS A . n A 1 77 ILE 77 92 92 ILE ILE A . n A 1 78 VAL 78 93 93 VAL VAL A . n A 1 79 VAL 79 94 94 VAL VAL A . n A 1 80 HIS 80 95 95 HIS HIS A . n A 1 81 PRO 81 96 96 PRO PRO A . n A 1 82 TYR 82 97 97 TYR TYR A . n A 1 83 TRP 83 98 98 TRP TRP A . n A 1 84 ASN 84 99 99 ASN ASN A . n A 1 85 THR 85 100 100 THR THR A . n A 1 86 ASP 86 101 101 ASP ASP A . n A 1 87 ASP 87 102 102 ASP ASP A . n A 1 88 VAL 88 103 103 VAL VAL A . n A 1 89 ALA 89 104 104 ALA ALA A . n A 1 90 ALA 90 105 105 ALA ALA A . n A 1 91 GLY 91 106 106 GLY GLY A . n A 1 92 TYR 92 107 107 TYR TYR A . n A 1 93 ASP 93 108 108 ASP ASP A . n A 1 94 ILE 94 109 109 ILE ILE A . n A 1 95 ALA 95 110 110 ALA ALA A . n A 1 96 LEU 96 111 111 LEU LEU A . n A 1 97 LEU 97 112 112 LEU LEU A . n A 1 98 ARG 98 113 113 ARG ARG A . n A 1 99 LEU 99 114 114 LEU LEU A . n A 1 100 ALA 100 115 115 ALA ALA A . n A 1 101 GLN 101 116 116 GLN GLN A . n A 1 102 SER 102 117 117 SER SER A . n A 1 103 VAL 103 118 118 VAL VAL A . n A 1 104 THR 104 119 119 THR THR A . n A 1 105 LEU 105 120 120 LEU LEU A . n A 1 106 ASN 106 121 121 ASN ASN A . n A 1 107 SER 107 122 122 SER SER A . n A 1 108 TYR 108 123 123 TYR TYR A . n A 1 109 VAL 109 124 124 VAL VAL A . n A 1 110 GLN 110 125 125 GLN GLN A . n A 1 111 LEU 111 126 126 LEU LEU A . n A 1 112 GLY 112 127 127 GLY GLY A . n A 1 113 VAL 113 128 128 VAL VAL A . n A 1 114 LEU 114 129 129 LEU LEU A . n A 1 115 PRO 115 130 130 PRO PRO A . n A 1 116 ARG 116 131 131 ARG ARG A . n A 1 117 ALA 117 132 132 ALA ALA A . n A 1 118 GLY 118 133 133 GLY GLY A . n A 1 119 THR 119 134 134 THR THR A . n A 1 120 ILE 120 135 135 ILE ILE A . n A 1 121 LEU 121 136 136 LEU LEU A . n A 1 122 ALA 122 137 137 ALA ALA A . n A 1 123 ASN 123 138 138 ASN ASN A . n A 1 124 ASN 124 139 139 ASN ASN A . n A 1 125 SER 125 140 140 SER SER A . n A 1 126 PRO 126 141 141 PRO PRO A . n A 1 127 CYS 127 142 142 CYS CYS A . n A 1 128 TYR 128 143 143 TYR TYR A . n A 1 129 ILE 129 144 144 ILE ILE A . n A 1 130 THR 130 145 145 THR THR A . n A 1 131 GLY 131 146 146 GLY GLY A . n A 1 132 TRP 132 147 147 TRP TRP A . n A 1 133 GLY 133 148 148 GLY GLY A . n A 1 134 LEU 134 149 149 LEU LEU A . n A 1 135 THR 135 150 150 THR THR A . n A 1 136 ARG 136 151 151 ARG ARG A . n A 1 137 THR 137 152 152 THR THR A . n A 1 138 ASN 138 153 153 ASN ASN A . n A 1 139 GLY 139 154 154 GLY GLY A . n A 1 140 GLN 140 155 155 GLN GLN A . n A 1 141 LEU 141 156 156 LEU LEU A . n A 1 142 ALA 142 157 157 ALA ALA A . n A 1 143 GLN 143 158 158 GLN GLN A . n A 1 144 THR 144 159 159 THR THR A . n A 1 145 LEU 145 160 160 LEU LEU A . n A 1 146 GLN 146 161 161 GLN GLN A . n A 1 147 GLN 147 162 162 GLN GLN A . n A 1 148 ALA 148 163 163 ALA ALA A . n A 1 149 TYR 149 164 164 TYR TYR A . n A 1 150 LEU 150 165 165 LEU LEU A . n A 1 151 PRO 151 166 166 PRO PRO A . n A 1 152 THR 152 167 167 THR THR A . n A 1 153 VAL 153 168 168 VAL VAL A . n A 1 154 ASP 154 169 169 ASP ASP A . n A 1 155 TYR 155 170 170 TYR TYR A . n A 1 156 ALA 156 171 171 ALA ALA A . n A 1 157 ILE 157 172 172 ILE ILE A . n A 1 158 CYS 158 173 173 CYS CYS A . n A 1 159 SER 159 174 174 SER SER A . n A 1 160 SER 160 175 175 SER SER A . n A 1 161 SER 161 176 176 SER SER A . n A 1 162 SER 162 177 177 SER SER A . n A 1 163 TYR 163 178 178 TYR TYR A . n A 1 164 TRP 164 179 179 TRP TRP A . n A 1 165 GLY 165 180 180 GLY GLY A . n A 1 166 SER 166 181 181 SER SER A . n A 1 167 THR 167 182 182 THR THR A . n A 1 168 VAL 168 183 183 VAL VAL A . n A 1 169 LYS 169 184 184 LYS LYS A . n A 1 170 ASN 170 185 185 ASN ASN A . n A 1 171 SER 171 186 186 SER SER A . n A 1 172 MET 172 187 187 MET MET A . n A 1 173 VAL 173 188 188 VAL VAL A . n A 1 174 CYS 174 189 189 CYS CYS A . n A 1 175 ALA 175 190 190 ALA ALA A . n A 1 176 GLY 176 191 191 GLY GLY A . n A 1 177 GLY 177 192 192 GLY GLY A . n A 1 178 ASP 178 193 193 ASP ASP A . n A 1 179 GLY 179 194 194 GLY GLY A . n A 1 180 VAL 180 195 195 VAL VAL A . n A 1 181 ARG 181 196 196 ARG ARG A . n A 1 182 SER 182 197 197 SER SER A . n A 1 183 GLY 183 198 198 GLY GLY A . n A 1 184 CYS 184 199 199 CYS CYS A . n A 1 185 GLN 185 200 200 GLN GLN A . n A 1 186 GLY 186 201 201 GLY GLY A . n A 1 187 ASP 187 202 202 ASP ASP A . n A 1 188 SER 188 203 203 SER SER A . n A 1 189 GLY 189 204 204 GLY GLY A . n A 1 190 GLY 190 205 205 GLY GLY A . n A 1 191 PRO 191 206 206 PRO PRO A . n A 1 192 LEU 192 207 207 LEU LEU A . n A 1 193 HIS 193 208 208 HIS HIS A . n A 1 194 CYS 194 209 209 CYS CYS A . n A 1 195 LEU 195 210 210 LEU LEU A . n A 1 196 VAL 196 211 211 VAL VAL A . n A 1 197 ASN 197 212 212 ASN ASN A . n A 1 198 GLY 198 213 213 GLY GLY A . n A 1 199 GLN 199 214 214 GLN GLN A . n A 1 200 TYR 200 215 215 TYR TYR A . n A 1 201 ALA 201 216 216 ALA ALA A . n A 1 202 VAL 202 217 217 VAL VAL A . n A 1 203 HIS 203 218 218 HIS HIS A . n A 1 204 GLY 204 219 219 GLY GLY A . n A 1 205 VAL 205 220 220 VAL VAL A . n A 1 206 THR 206 221 221 THR THR A . n A 1 207 SER 207 222 222 SER SER A . n A 1 208 PHE 208 223 223 PHE PHE A . n A 1 209 VAL 209 224 224 VAL VAL A . n A 1 210 SER 210 225 225 SER SER A . n A 1 211 ARG 211 226 226 ARG ARG A . n A 1 212 LEU 212 227 227 LEU LEU A . n A 1 213 GLY 213 228 228 GLY GLY A . n A 1 214 CYS 214 229 229 CYS CYS A . n A 1 215 ASN 215 230 230 ASN ASN A . n A 1 216 VAL 216 231 231 VAL VAL A . n A 1 217 THR 217 232 232 THR THR A . n A 1 218 ARG 218 233 233 ARG ARG A . n A 1 219 LYS 219 234 234 LYS LYS A . n A 1 220 PRO 220 235 235 PRO PRO A . n A 1 221 THR 221 236 236 THR THR A . n A 1 222 VAL 222 237 237 VAL VAL A . n A 1 223 PHE 223 238 238 PHE PHE A . n A 1 224 THR 224 239 239 THR THR A . n A 1 225 ARG 225 240 240 ARG ARG A . n A 1 226 VAL 226 241 241 VAL VAL A . n A 1 227 SER 227 242 242 SER SER A . n A 1 228 ALA 228 243 243 ALA ALA A . n A 1 229 TYR 229 244 244 TYR TYR A . n A 1 230 ILE 230 245 245 ILE ILE A . n A 1 231 SER 231 246 246 SER SER A . n A 1 232 TRP 232 247 247 TRP TRP A . n A 1 233 ILE 233 248 248 ILE ILE A . n A 1 234 ASN 234 249 249 ASN ASN A . n A 1 235 ASN 235 250 250 ASN ASN A . n A 1 236 VAL 236 251 251 VAL VAL A . n A 1 237 ILE 237 252 252 ILE ILE A . n A 1 238 ALA 238 253 253 ALA ALA A . n A 1 239 SER 239 254 254 SER SER A . n A 1 240 ASN 240 255 255 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 0Z1 1 256 256 0Z1 TFA A . C 3 CA 1 280 280 CA CA A . D 4 SO4 1 290 290 SO4 SO4 A . E 5 ACY 1 300 300 ACY ACY A . F 6 HOH 1 301 301 HOH HOH A . F 6 HOH 2 302 302 HOH HOH A . F 6 HOH 3 303 303 HOH HOH A . F 6 HOH 4 304 304 HOH HOH A . F 6 HOH 5 305 305 HOH HOH A . F 6 HOH 6 306 306 HOH HOH A . F 6 HOH 7 307 307 HOH HOH A . F 6 HOH 8 308 308 HOH HOH A . F 6 HOH 9 309 309 HOH HOH A . F 6 HOH 10 311 311 HOH HOH A . F 6 HOH 11 312 312 HOH HOH A . F 6 HOH 12 313 313 HOH HOH A . F 6 HOH 13 314 314 HOH HOH A . F 6 HOH 14 315 315 HOH HOH A . F 6 HOH 15 316 316 HOH HOH A . F 6 HOH 16 317 317 HOH HOH A . F 6 HOH 17 318 318 HOH HOH A . F 6 HOH 18 319 319 HOH HOH A . F 6 HOH 19 320 320 HOH HOH A . F 6 HOH 20 321 321 HOH HOH A . F 6 HOH 21 322 322 HOH HOH A . F 6 HOH 22 323 323 HOH HOH A . F 6 HOH 23 324 324 HOH HOH A . F 6 HOH 24 326 326 HOH HOH A . F 6 HOH 25 328 328 HOH HOH A . F 6 HOH 26 402 402 HOH HOH A . F 6 HOH 27 403 403 HOH HOH A . F 6 HOH 28 404 404 HOH HOH A . F 6 HOH 29 405 405 HOH HOH A . F 6 HOH 30 407 407 HOH HOH A . F 6 HOH 31 411 411 HOH HOH A . F 6 HOH 32 413 413 HOH HOH A . F 6 HOH 33 414 414 HOH HOH A . F 6 HOH 34 416 416 HOH HOH A . F 6 HOH 35 418 418 HOH HOH A . F 6 HOH 36 421 421 HOH HOH A . F 6 HOH 37 423 423 HOH HOH A . F 6 HOH 38 425 425 HOH HOH A . F 6 HOH 39 427 427 HOH HOH A . F 6 HOH 40 430 430 HOH HOH A . F 6 HOH 41 432 432 HOH HOH A . F 6 HOH 42 438 438 HOH HOH A . F 6 HOH 43 439 439 HOH HOH A . F 6 HOH 44 441 441 HOH HOH A . F 6 HOH 45 444 444 HOH HOH A . F 6 HOH 46 445 445 HOH HOH A . F 6 HOH 47 450 450 HOH HOH A . F 6 HOH 48 451 451 HOH HOH A . F 6 HOH 49 455 455 HOH HOH A . F 6 HOH 50 460 460 HOH HOH A . F 6 HOH 51 515 515 HOH HOH A . F 6 HOH 52 516 516 HOH HOH A . F 6 HOH 53 518 518 HOH HOH A . F 6 HOH 54 525 525 HOH HOH A . F 6 HOH 55 531 531 HOH HOH A . F 6 HOH 56 536 536 HOH HOH A . F 6 HOH 57 537 537 HOH HOH A . F 6 HOH 58 538 538 HOH HOH A . F 6 HOH 59 539 539 HOH HOH A . F 6 HOH 60 541 541 HOH HOH A . F 6 HOH 61 542 542 HOH HOH A . F 6 HOH 62 574 574 HOH HOH A . F 6 HOH 63 576 576 HOH HOH A . F 6 HOH 64 577 577 HOH HOH A . F 6 HOH 65 578 578 HOH HOH A . F 6 HOH 66 579 579 HOH HOH A . F 6 HOH 67 581 581 HOH HOH A . F 6 HOH 68 582 582 HOH HOH A . F 6 HOH 69 585 585 HOH HOH A . F 6 HOH 70 588 588 HOH HOH A . F 6 HOH 71 593 593 HOH HOH A . F 6 HOH 72 595 595 HOH HOH A . F 6 HOH 73 596 596 HOH HOH A . F 6 HOH 74 597 597 HOH HOH A . F 6 HOH 75 598 598 HOH HOH A . F 6 HOH 76 599 599 HOH HOH A . F 6 HOH 77 600 600 HOH HOH A . F 6 HOH 78 602 602 HOH HOH A . F 6 HOH 79 604 604 HOH HOH A . F 6 HOH 80 607 607 HOH HOH A . F 6 HOH 81 608 608 HOH HOH A . F 6 HOH 82 611 611 HOH HOH A . F 6 HOH 83 613 613 HOH HOH A . F 6 HOH 84 614 614 HOH HOH A . F 6 HOH 85 616 616 HOH HOH A . F 6 HOH 86 623 623 HOH HOH A . F 6 HOH 87 628 628 HOH HOH A . F 6 HOH 88 630 630 HOH HOH A . F 6 HOH 89 632 632 HOH HOH A . F 6 HOH 90 651 651 HOH HOH A . F 6 HOH 91 654 654 HOH HOH A . F 6 HOH 92 655 655 HOH HOH A . F 6 HOH 93 657 657 HOH HOH A . F 6 HOH 94 658 658 HOH HOH A . F 6 HOH 95 660 660 HOH HOH A . F 6 HOH 96 663 663 HOH HOH A . F 6 HOH 97 671 671 HOH HOH A . F 6 HOH 98 672 672 HOH HOH A . F 6 HOH 99 673 673 HOH HOH A . F 6 HOH 100 674 674 HOH HOH A . F 6 HOH 101 675 675 HOH HOH A . F 6 HOH 102 676 676 HOH HOH A . F 6 HOH 103 677 677 HOH HOH A . F 6 HOH 104 678 678 HOH HOH A . F 6 HOH 105 679 679 HOH HOH A . F 6 HOH 106 682 682 HOH HOH A . F 6 HOH 107 684 684 HOH HOH A . F 6 HOH 108 685 685 HOH HOH A . F 6 HOH 109 686 686 HOH HOH A . F 6 HOH 110 687 687 HOH HOH A . F 6 HOH 111 688 688 HOH HOH A . F 6 HOH 112 689 689 HOH HOH A . F 6 HOH 113 691 691 HOH HOH A . F 6 HOH 114 692 692 HOH HOH A . F 6 HOH 115 693 693 HOH HOH A . F 6 HOH 116 694 694 HOH HOH A . F 6 HOH 117 698 698 HOH HOH A . F 6 HOH 118 699 699 HOH HOH A . F 6 HOH 119 701 701 HOH HOH A . F 6 HOH 120 702 702 HOH HOH A . F 6 HOH 121 703 703 HOH HOH A . F 6 HOH 122 704 704 HOH HOH A . F 6 HOH 123 705 705 HOH HOH A . F 6 HOH 124 706 706 HOH HOH A . F 6 HOH 125 707 707 HOH HOH A . F 6 HOH 126 708 708 HOH HOH A . F 6 HOH 127 709 709 HOH HOH A . F 6 HOH 128 710 710 HOH HOH A . F 6 HOH 129 711 711 HOH HOH A . F 6 HOH 130 712 712 HOH HOH A . F 6 HOH 131 713 713 HOH HOH A . F 6 HOH 132 714 714 HOH HOH A . F 6 HOH 133 715 715 HOH HOH A . F 6 HOH 134 716 716 HOH HOH A . F 6 HOH 135 717 717 HOH HOH A . F 6 HOH 136 718 718 HOH HOH A . F 6 HOH 137 719 719 HOH HOH A . F 6 HOH 138 720 720 HOH HOH A . F 6 HOH 139 721 721 HOH HOH A . F 6 HOH 140 722 722 HOH HOH A . F 6 HOH 141 723 723 HOH HOH A . F 6 HOH 142 724 724 HOH HOH A . F 6 HOH 143 725 725 HOH HOH A . F 6 HOH 144 726 726 HOH HOH A . F 6 HOH 145 727 727 HOH HOH A . F 6 HOH 146 728 728 HOH HOH A . F 6 HOH 147 729 729 HOH HOH A . F 6 HOH 148 730 730 HOH HOH A . F 6 HOH 149 731 731 HOH HOH A . F 6 HOH 150 732 732 HOH HOH A . F 6 HOH 151 733 733 HOH HOH A . F 6 HOH 152 734 734 HOH HOH A . F 6 HOH 153 735 735 HOH HOH A . F 6 HOH 154 736 736 HOH HOH A . F 6 HOH 155 737 737 HOH HOH A . F 6 HOH 156 738 738 HOH HOH A . F 6 HOH 157 739 739 HOH HOH A . F 6 HOH 158 740 740 HOH HOH A . F 6 HOH 159 741 741 HOH HOH A . F 6 HOH 160 742 742 HOH HOH A . F 6 HOH 161 743 743 HOH HOH A . F 6 HOH 162 744 744 HOH HOH A . F 6 HOH 163 745 745 HOH HOH A . F 6 HOH 164 746 746 HOH HOH A . F 6 HOH 165 747 747 HOH HOH A . F 6 HOH 166 748 748 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_000365 _pdbx_molecule_features.name TRIFLUOROACETYL-L-LYSYL-L-PROLYL-P-ISOPROPYLANILIDE _pdbx_molecule_features.type Peptide-like _pdbx_molecule_features.class Inhibitor _pdbx_molecule_features.details ? # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_000365 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 100.3 ? 2 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 O ? A GLN 64 ? A GLN 79 ? 1_555 151.1 ? 3 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 O ? A GLN 64 ? A GLN 79 ? 1_555 99.5 ? 4 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 O ? A ASN 61 ? A ASN 76 ? 1_555 79.4 ? 5 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 O ? A ASN 61 ? A ASN 76 ? 1_555 169.7 ? 6 O ? A GLN 64 ? A GLN 79 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 O ? A ASN 61 ? A ASN 76 ? 1_555 84.7 ? 7 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 113.1 ? 8 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 86.4 ? 9 O ? A GLN 64 ? A GLN 79 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 88.8 ? 10 O ? A ASN 61 ? A ASN 76 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 84.3 ? 11 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 40.4 ? 12 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 91.7 ? 13 O ? A GLN 64 ? A GLN 79 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 158.3 ? 14 O ? A ASN 61 ? A ASN 76 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 81.5 ? 15 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 73.3 ? 16 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 O ? F HOH . ? A HOH 607 ? 1_555 68.3 ? 17 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 O ? F HOH . ? A HOH 607 ? 1_555 95.7 ? 18 O ? A GLN 64 ? A GLN 79 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 O ? F HOH . ? A HOH 607 ? 1_555 89.1 ? 19 O ? A ASN 61 ? A ASN 76 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 O ? F HOH . ? A HOH 607 ? 1_555 93.8 ? 20 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 O ? F HOH . ? A HOH 607 ? 1_555 177.3 ? 21 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? C CA . ? A CA 280 ? 1_555 O ? F HOH . ? A HOH 607 ? 1_555 108.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-04-30 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-12-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Non-polymer description' 6 3 'Structure model' 'Structure summary' 7 3 'Structure model' 'Version format compliance' 8 4 'Structure model' Other # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET THE SHEETS PRESENTED AS *S1* AND *S2* IN SHEET RECORDS BELOW ARE ACTUALLY TWO SIX-STRANDED BETA-BARRELS. THIS IS REPRESENTED BY TWO SEVEN-STRANDED SHEETS IN WHICH THE FIRST AND LAST STRANDS OF EACH SHEET ARE IDENTICAL. ; # _pdbx_entry_details.entry_id 1ELA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE IDENTITY OF ASN A 81 AGREES WITH THE SEQUENCES OF SEVERAL OTHER ELASTASE STRUCTURES. THE AUTHORS THEREFORE BELIEVE IT TO BE CORRECT. ; # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 60 ? ? CD2 A HIS 60 ? ? 1.301 1.373 -0.072 0.011 N 2 1 NE2 A HIS 95 ? ? CD2 A HIS 95 ? ? 1.297 1.373 -0.076 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.48 120.30 3.18 0.50 N 2 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH2 A ARG 24 ? ? 116.82 120.30 -3.48 0.50 N 3 1 CD1 A TRP 27 ? ? CG A TRP 27 ? ? CD2 A TRP 27 ? ? 112.40 106.30 6.10 0.80 N 4 1 CE2 A TRP 27 ? ? CD2 A TRP 27 ? ? CG A TRP 27 ? ? 101.80 107.30 -5.50 0.80 N 5 1 CD1 A TRP 41 ? ? CG A TRP 41 ? ? CD2 A TRP 41 ? ? 113.88 106.30 7.58 0.80 N 6 1 CE2 A TRP 41 ? ? CD2 A TRP 41 ? ? CG A TRP 41 ? ? 101.47 107.30 -5.83 0.80 N 7 1 CD1 A TRP 54 ? ? CG A TRP 54 ? ? CD2 A TRP 54 ? ? 111.66 106.30 5.36 0.80 N 8 1 CE2 A TRP 54 ? ? CD2 A TRP 54 ? ? CG A TRP 54 ? ? 101.91 107.30 -5.39 0.80 N 9 1 CD1 A TRP 98 ? ? CG A TRP 98 ? ? CD2 A TRP 98 ? ? 111.98 106.30 5.68 0.80 N 10 1 CE2 A TRP 98 ? ? CD2 A TRP 98 ? ? CG A TRP 98 ? ? 101.87 107.30 -5.43 0.80 N 11 1 NE A ARG 113 ? ? CZ A ARG 113 ? ? NH1 A ARG 113 ? ? 123.36 120.30 3.06 0.50 N 12 1 CD1 A TRP 147 ? ? CG A TRP 147 ? ? CD2 A TRP 147 ? ? 113.06 106.30 6.76 0.80 N 13 1 CE2 A TRP 147 ? ? CD2 A TRP 147 ? ? CG A TRP 147 ? ? 101.26 107.30 -6.04 0.80 N 14 1 CD1 A TRP 179 ? ? CG A TRP 179 ? ? CD2 A TRP 179 ? ? 112.21 106.30 5.91 0.80 N 15 1 CE2 A TRP 179 ? ? CD2 A TRP 179 ? ? CG A TRP 179 ? ? 102.21 107.30 -5.09 0.80 N 16 1 NE A ARG 226 ? ? CZ A ARG 226 ? ? NH2 A ARG 226 ? ? 113.15 120.30 -7.15 0.50 N 17 1 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 123.81 120.30 3.51 0.50 N 18 1 NE A ARG 240 ? ? CZ A ARG 240 ? ? NH1 A ARG 240 ? ? 126.01 120.30 5.71 0.50 N 19 1 NE A ARG 240 ? ? CZ A ARG 240 ? ? NH2 A ARG 240 ? ? 116.33 120.30 -3.97 0.50 N 20 1 CD1 A TRP 247 ? ? CG A TRP 247 ? ? CD2 A TRP 247 ? ? 112.74 106.30 6.44 0.80 N 21 1 CE2 A TRP 247 ? ? CD2 A TRP 247 ? ? CG A TRP 247 ? ? 101.73 107.30 -5.57 0.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 75 ? ? -131.09 -52.78 2 1 ASN A 121 ? ? -160.06 -162.28 3 1 TYR A 178 ? ? -106.00 -117.27 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '6-ammonio-N-(trifluoroacetyl)-L-norleucyl-N-[4-(1-methylethyl)phenyl]-L-prolinamide' 0Z1 3 'CALCIUM ION' CA 4 'SULFATE ION' SO4 5 'ACETIC ACID' ACY 6 water HOH #