data_1EMB # _entry.id 1EMB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1EMB pdb_00001emb 10.2210/pdb1emb/pdb WWPDB D_1000173077 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EMB _pdbx_database_status.recvd_initial_deposition_date 1997-01-08 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Brejc, K.' 1 'Sixma, T.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structural basis for dual excitation and photoisomerization of the Aequorea victoria green fluorescent protein.' Proc.Natl.Acad.Sci.USA 94 2306 2311 1997 PNASA6 US 0027-8424 0040 ? 9122190 10.1073/pnas.94.6.2306 1 'Crystal Structure of the Aequorea Victoria Green Fluorescent Protein' Science 273 1392 ? 1996 SCIEAS US 0036-8075 0038 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brejc, K.' 1 ? primary 'Sixma, T.K.' 2 ? primary 'Kitts, P.A.' 3 ? primary 'Kain, S.R.' 4 ? primary 'Tsien, R.Y.' 5 ? primary 'Ormo, M.' 6 ? primary 'Remington, S.J.' 7 ? 1 'Ormo, M.' 8 ? 1 'Cubitt, A.B.' 9 ? 1 'Kallio, K.' 10 ? 1 'Gross, L.A.' 11 ? 1 'Tsien, R.Y.' 12 ? 1 'Remington, S.J.' 13 ? # _cell.entry_id 1EMB _cell.length_a 51.900 _cell.length_b 63.200 _cell.length_c 68.800 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EMB _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GREEN FLUORESCENT PROTEIN' 26945.383 1 ? Q80R ? 'CHROMOPHORE CONTAINING PROTEIN 65 - 67 DENOTED AS CRO' 2 water nat water 18.015 74 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name GFP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTF(CRO)VQCFSRYPDHM KRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQK NGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKR HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LYS n 1 4 GLY n 1 5 GLU n 1 6 GLU n 1 7 LEU n 1 8 PHE n 1 9 THR n 1 10 GLY n 1 11 VAL n 1 12 VAL n 1 13 PRO n 1 14 ILE n 1 15 LEU n 1 16 VAL n 1 17 GLU n 1 18 LEU n 1 19 ASP n 1 20 GLY n 1 21 ASP n 1 22 VAL n 1 23 ASN n 1 24 GLY n 1 25 HIS n 1 26 LYS n 1 27 PHE n 1 28 SER n 1 29 VAL n 1 30 SER n 1 31 GLY n 1 32 GLU n 1 33 GLY n 1 34 GLU n 1 35 GLY n 1 36 ASP n 1 37 ALA n 1 38 THR n 1 39 TYR n 1 40 GLY n 1 41 LYS n 1 42 LEU n 1 43 THR n 1 44 LEU n 1 45 LYS n 1 46 PHE n 1 47 ILE n 1 48 CYS n 1 49 THR n 1 50 THR n 1 51 GLY n 1 52 LYS n 1 53 LEU n 1 54 PRO n 1 55 VAL n 1 56 PRO n 1 57 TRP n 1 58 PRO n 1 59 THR n 1 60 LEU n 1 61 VAL n 1 62 THR n 1 63 THR n 1 64 PHE n 1 65 CRO n 1 66 VAL n 1 67 GLN n 1 68 CYS n 1 69 PHE n 1 70 SER n 1 71 ARG n 1 72 TYR n 1 73 PRO n 1 74 ASP n 1 75 HIS n 1 76 MET n 1 77 LYS n 1 78 ARG n 1 79 HIS n 1 80 ASP n 1 81 PHE n 1 82 PHE n 1 83 LYS n 1 84 SER n 1 85 ALA n 1 86 MET n 1 87 PRO n 1 88 GLU n 1 89 GLY n 1 90 TYR n 1 91 VAL n 1 92 GLN n 1 93 GLU n 1 94 ARG n 1 95 THR n 1 96 ILE n 1 97 PHE n 1 98 PHE n 1 99 LYS n 1 100 ASP n 1 101 ASP n 1 102 GLY n 1 103 ASN n 1 104 TYR n 1 105 LYS n 1 106 THR n 1 107 ARG n 1 108 ALA n 1 109 GLU n 1 110 VAL n 1 111 LYS n 1 112 PHE n 1 113 GLU n 1 114 GLY n 1 115 ASP n 1 116 THR n 1 117 LEU n 1 118 VAL n 1 119 ASN n 1 120 ARG n 1 121 ILE n 1 122 GLU n 1 123 LEU n 1 124 LYS n 1 125 GLY n 1 126 ILE n 1 127 ASP n 1 128 PHE n 1 129 LYS n 1 130 GLU n 1 131 ASP n 1 132 GLY n 1 133 ASN n 1 134 ILE n 1 135 LEU n 1 136 GLY n 1 137 HIS n 1 138 LYS n 1 139 LEU n 1 140 GLU n 1 141 TYR n 1 142 ASN n 1 143 TYR n 1 144 ASN n 1 145 SER n 1 146 HIS n 1 147 ASN n 1 148 VAL n 1 149 TYR n 1 150 ILE n 1 151 MET n 1 152 ALA n 1 153 ASP n 1 154 LYS n 1 155 GLN n 1 156 LYS n 1 157 ASN n 1 158 GLY n 1 159 ILE n 1 160 LYS n 1 161 VAL n 1 162 ASN n 1 163 PHE n 1 164 LYS n 1 165 ILE n 1 166 ARG n 1 167 HIS n 1 168 ASN n 1 169 ILE n 1 170 GLU n 1 171 ASP n 1 172 GLY n 1 173 SER n 1 174 VAL n 1 175 GLN n 1 176 LEU n 1 177 ALA n 1 178 ASP n 1 179 HIS n 1 180 TYR n 1 181 GLN n 1 182 GLN n 1 183 ASN n 1 184 THR n 1 185 PRO n 1 186 ILE n 1 187 GLY n 1 188 ASP n 1 189 GLY n 1 190 PRO n 1 191 VAL n 1 192 LEU n 1 193 LEU n 1 194 PRO n 1 195 ASP n 1 196 ASN n 1 197 HIS n 1 198 TYR n 1 199 LEU n 1 200 SER n 1 201 THR n 1 202 GLN n 1 203 SER n 1 204 ALA n 1 205 LEU n 1 206 SER n 1 207 LYS n 1 208 ASP n 1 209 PRO n 1 210 ASN n 1 211 GLU n 1 212 LYS n 1 213 ARG n 1 214 ASP n 1 215 HIS n 1 216 MET n 1 217 VAL n 1 218 LEU n 1 219 LEU n 1 220 GLU n 1 221 PHE n 1 222 VAL n 1 223 THR n 1 224 ALA n 1 225 ALA n 1 226 GLY n 1 227 ILE n 1 228 THR n 1 229 HIS n 1 230 GLY n 1 231 MET n 1 232 ASP n 1 233 GLU n 1 234 LEU n 1 235 TYR n 1 236 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Aequorea _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aequorea victoria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6100 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location CYTOPLASM _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector TU#58 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GFP_AEQVI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P42212 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKR HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EMB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 236 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42212 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1EMB CRO A 65 ? UNP P42212 SER 65 chromophore 66 1 1 1EMB CRO A 65 ? UNP P42212 TYR 66 chromophore 66 2 1 1EMB CRO A 65 ? UNP P42212 GLY 67 chromophore 66 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CRO 'L-peptide linking' n '{2-[(1R,2R)-1-amino-2-hydroxypropyl]-4-(4-hydroxybenzylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 'PEPTIDE DERIVED CHROMOPHORE' 'C15 H17 N3 O5' 319.313 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1EMB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_percent_sol 41. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 3.8 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'PROTEIN WAS CRYSTALLIZED FROM 50 MM KH2PO4 AND 20 % (W/V) PEG 8000, PH 3.8.' # _diffrn.id 1 _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1995-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'NI FILTER' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1EMB _reflns.observed_criterion_sigma_I 3. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.13 _reflns.number_obs 13001 _reflns.number_all ? _reflns.percent_possible_obs 91.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.0610000 _reflns.pdbx_netI_over_sigmaI 7.1 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.8 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.13 _reflns_shell.d_res_low 2.2 _reflns_shell.percent_possible_all 54.5 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.1860000 _reflns_shell.meanI_over_sigI_obs 3.9 _reflns_shell.pdbx_redundancy 5.3 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1EMB _refine.ls_number_reflns_obs 13001 _refine.ls_number_reflns_all 12458 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.13 _refine.ls_percent_reflns_obs 90.0 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1960000 _refine.ls_R_factor_R_free 0.2500000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5. _refine.ls_number_reflns_R_free 607 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol 0.8 _refine.solvent_model_param_bsol 145.5 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1EMA' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model 'TNT BCORREL' _refine.pdbx_stereochemistry_target_values 'TNT PROTGEO' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1833 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 74 _refine_hist.number_atoms_total 1907 _refine_hist.d_res_high 2.13 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.011 ? 0.800 1877 'X-RAY DIFFRACTION' ? t_angle_deg 1.534 ? 3.00 2531 'X-RAY DIFFRACTION' ? t_dihedral_angle_d 19.508 ? 0.00 1096 'X-RAY DIFFRACTION' ? t_incorr_chiral_ct 0 ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes 0.006 ? 2.0 56 'X-RAY DIFFRACTION' ? t_gen_planes 0.014 ? 6.0 265 'X-RAY DIFFRACTION' ? t_it 2.327 ? 5.0 1849 'X-RAY DIFFRACTION' ? t_nbd 0.032 ? 10.0 11 'X-RAY DIFFRACTION' ? # _pdbx_refine.entry_id 1EMB _pdbx_refine.R_factor_all_no_cutoff ? _pdbx_refine.R_factor_obs_no_cutoff 0.1960000 _pdbx_refine.free_R_factor_no_cutoff 0.2540000 _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff 5. _pdbx_refine.free_R_val_test_set_ct_no_cutoff 607 _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff ? _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.free_R_error_no_cutoff ? # _struct.entry_id 1EMB _struct.title 'GREEN FLUORESCENT PROTEIN (GFP) FROM AEQUOREA VICTORIA, GLN 80 REPLACED WITH ARG' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EMB _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' _struct_keywords.text 'FLUORESCENT PROTEIN, BETA-BARREL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 5 ? PHE A 8 ? GLU A 5 PHE A 8 5 ? 4 HELX_P HELX_P2 2 ALA A 37 ? TYR A 39 ? ALA A 37 TYR A 39 5 ? 3 HELX_P HELX_P3 3 TRP A 57 ? LEU A 60 ? TRP A 57 LEU A 60 1 ? 4 HELX_P HELX_P4 4 GLN A 67 ? PHE A 69 ? GLN A 69 PHE A 71 5 ? 3 HELX_P HELX_P5 5 ASP A 74 ? HIS A 79 ? ASP A 76 HIS A 81 5 ? 6 HELX_P HELX_P6 6 PHE A 81 ? ALA A 85 ? PHE A 83 ALA A 87 1 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PHE 64 C ? ? ? 1_555 A CRO 65 N1 ? ? A PHE 64 A CRO 66 1_555 ? ? ? ? ? ? ? 1.350 ? ? covale2 covale both ? A CRO 65 C3 ? ? ? 1_555 A VAL 66 N ? ? A CRO 66 A VAL 68 1_555 ? ? ? ? ? ? ? 1.323 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 86 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 88 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 87 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 89 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.73 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel A 10 11 ? anti-parallel A 11 12 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 25 ? GLY A 35 ? HIS A 25 GLY A 35 A 2 VAL A 12 ? VAL A 22 ? VAL A 12 VAL A 22 A 3 THR A 116 ? ILE A 126 ? THR A 118 ILE A 128 A 4 ASN A 103 ? GLU A 113 ? ASN A 105 GLU A 115 A 5 TYR A 90 ? PHE A 98 ? TYR A 92 PHE A 100 A 6 VAL A 174 ? PRO A 185 ? VAL A 176 PRO A 187 A 7 GLY A 158 ? ASN A 168 ? GLY A 160 ASN A 170 A 8 HIS A 146 ? ASP A 153 ? HIS A 148 ASP A 155 A 9 HIS A 197 ? SER A 206 ? HIS A 199 SER A 208 A 10 HIS A 215 ? ALA A 225 ? HIS A 217 ALA A 227 A 11 LYS A 41 ? CYS A 48 ? LYS A 41 CYS A 48 A 12 VAL A 29 ? ASP A 36 ? VAL A 29 ASP A 36 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O HIS A 25 ? O HIS A 25 N VAL A 22 ? N VAL A 22 A 2 3 O LEU A 15 ? O LEU A 15 N LEU A 117 ? N LEU A 119 A 3 4 O THR A 116 ? O THR A 118 N GLU A 113 ? N GLU A 115 A 4 5 O TYR A 104 ? O TYR A 106 N ILE A 96 ? N ILE A 98 A 5 6 O VAL A 91 ? O VAL A 93 N THR A 184 ? N THR A 186 A 6 7 O GLN A 175 ? O GLN A 177 N HIS A 167 ? N HIS A 169 A 7 8 O GLY A 158 ? O GLY A 160 N ASP A 153 ? N ASP A 155 A 8 9 O HIS A 146 ? O HIS A 148 N THR A 201 ? N THR A 203 A 9 10 O TYR A 198 ? O TYR A 200 N ALA A 225 ? N ALA A 227 A 10 11 O MET A 216 ? O MET A 218 N PHE A 46 ? N PHE A 46 A 11 12 O LYS A 41 ? O LYS A 41 N ASP A 36 ? N ASP A 36 # _database_PDB_matrix.entry_id 1EMB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EMB _atom_sites.fract_transf_matrix[1][1] 0.019268 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015823 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014535 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 CRO 65 66 66 CRO CRO A . n A 1 66 VAL 66 68 68 VAL VAL A . n A 1 67 GLN 67 69 69 GLN GLN A . n A 1 68 CYS 68 70 70 CYS CYS A . n A 1 69 PHE 69 71 71 PHE PHE A . n A 1 70 SER 70 72 72 SER SER A . n A 1 71 ARG 71 73 73 ARG ARG A . n A 1 72 TYR 72 74 74 TYR TYR A . n A 1 73 PRO 73 75 75 PRO PRO A . n A 1 74 ASP 74 76 76 ASP ASP A . n A 1 75 HIS 75 77 77 HIS HIS A . n A 1 76 MET 76 78 78 MET MET A . n A 1 77 LYS 77 79 79 LYS LYS A . n A 1 78 ARG 78 80 80 ARG ARG A . n A 1 79 HIS 79 81 81 HIS HIS A . n A 1 80 ASP 80 82 82 ASP ASP A . n A 1 81 PHE 81 83 83 PHE PHE A . n A 1 82 PHE 82 84 84 PHE PHE A . n A 1 83 LYS 83 85 85 LYS LYS A . n A 1 84 SER 84 86 86 SER SER A . n A 1 85 ALA 85 87 87 ALA ALA A . n A 1 86 MET 86 88 88 MET MET A . n A 1 87 PRO 87 89 89 PRO PRO A . n A 1 88 GLU 88 90 90 GLU GLU A . n A 1 89 GLY 89 91 91 GLY GLY A . n A 1 90 TYR 90 92 92 TYR TYR A . n A 1 91 VAL 91 93 93 VAL VAL A . n A 1 92 GLN 92 94 94 GLN GLN A . n A 1 93 GLU 93 95 95 GLU GLU A . n A 1 94 ARG 94 96 96 ARG ARG A . n A 1 95 THR 95 97 97 THR THR A . n A 1 96 ILE 96 98 98 ILE ILE A . n A 1 97 PHE 97 99 99 PHE PHE A . n A 1 98 PHE 98 100 100 PHE PHE A . n A 1 99 LYS 99 101 101 LYS LYS A . n A 1 100 ASP 100 102 102 ASP ASP A . n A 1 101 ASP 101 103 103 ASP ASP A . n A 1 102 GLY 102 104 104 GLY GLY A . n A 1 103 ASN 103 105 105 ASN ASN A . n A 1 104 TYR 104 106 106 TYR TYR A . n A 1 105 LYS 105 107 107 LYS LYS A . n A 1 106 THR 106 108 108 THR THR A . n A 1 107 ARG 107 109 109 ARG ARG A . n A 1 108 ALA 108 110 110 ALA ALA A . n A 1 109 GLU 109 111 111 GLU GLU A . n A 1 110 VAL 110 112 112 VAL VAL A . n A 1 111 LYS 111 113 113 LYS LYS A . n A 1 112 PHE 112 114 114 PHE PHE A . n A 1 113 GLU 113 115 115 GLU GLU A . n A 1 114 GLY 114 116 116 GLY GLY A . n A 1 115 ASP 115 117 117 ASP ASP A . n A 1 116 THR 116 118 118 THR THR A . n A 1 117 LEU 117 119 119 LEU LEU A . n A 1 118 VAL 118 120 120 VAL VAL A . n A 1 119 ASN 119 121 121 ASN ASN A . n A 1 120 ARG 120 122 122 ARG ARG A . n A 1 121 ILE 121 123 123 ILE ILE A . n A 1 122 GLU 122 124 124 GLU GLU A . n A 1 123 LEU 123 125 125 LEU LEU A . n A 1 124 LYS 124 126 126 LYS LYS A . n A 1 125 GLY 125 127 127 GLY GLY A . n A 1 126 ILE 126 128 128 ILE ILE A . n A 1 127 ASP 127 129 129 ASP ASP A . n A 1 128 PHE 128 130 130 PHE PHE A . n A 1 129 LYS 129 131 131 LYS LYS A . n A 1 130 GLU 130 132 132 GLU GLU A . n A 1 131 ASP 131 133 133 ASP ASP A . n A 1 132 GLY 132 134 134 GLY GLY A . n A 1 133 ASN 133 135 135 ASN ASN A . n A 1 134 ILE 134 136 136 ILE ILE A . n A 1 135 LEU 135 137 137 LEU LEU A . n A 1 136 GLY 136 138 138 GLY GLY A . n A 1 137 HIS 137 139 139 HIS HIS A . n A 1 138 LYS 138 140 140 LYS LYS A . n A 1 139 LEU 139 141 141 LEU LEU A . n A 1 140 GLU 140 142 142 GLU GLU A . n A 1 141 TYR 141 143 143 TYR TYR A . n A 1 142 ASN 142 144 144 ASN ASN A . n A 1 143 TYR 143 145 145 TYR TYR A . n A 1 144 ASN 144 146 146 ASN ASN A . n A 1 145 SER 145 147 147 SER SER A . n A 1 146 HIS 146 148 148 HIS HIS A . n A 1 147 ASN 147 149 149 ASN ASN A . n A 1 148 VAL 148 150 150 VAL VAL A . n A 1 149 TYR 149 151 151 TYR TYR A . n A 1 150 ILE 150 152 152 ILE ILE A . n A 1 151 MET 151 153 153 MET MET A . n A 1 152 ALA 152 154 154 ALA ALA A . n A 1 153 ASP 153 155 155 ASP ASP A . n A 1 154 LYS 154 156 156 LYS LYS A . n A 1 155 GLN 155 157 157 GLN GLN A . n A 1 156 LYS 156 158 158 LYS LYS A . n A 1 157 ASN 157 159 159 ASN ASN A . n A 1 158 GLY 158 160 160 GLY GLY A . n A 1 159 ILE 159 161 161 ILE ILE A . n A 1 160 LYS 160 162 162 LYS LYS A . n A 1 161 VAL 161 163 163 VAL VAL A . n A 1 162 ASN 162 164 164 ASN ASN A . n A 1 163 PHE 163 165 165 PHE PHE A . n A 1 164 LYS 164 166 166 LYS LYS A . n A 1 165 ILE 165 167 167 ILE ILE A . n A 1 166 ARG 166 168 168 ARG ARG A . n A 1 167 HIS 167 169 169 HIS HIS A . n A 1 168 ASN 168 170 170 ASN ASN A . n A 1 169 ILE 169 171 171 ILE ILE A . n A 1 170 GLU 170 172 172 GLU GLU A . n A 1 171 ASP 171 173 173 ASP ASP A . n A 1 172 GLY 172 174 174 GLY GLY A . n A 1 173 SER 173 175 175 SER SER A . n A 1 174 VAL 174 176 176 VAL VAL A . n A 1 175 GLN 175 177 177 GLN GLN A . n A 1 176 LEU 176 178 178 LEU LEU A . n A 1 177 ALA 177 179 179 ALA ALA A . n A 1 178 ASP 178 180 180 ASP ASP A . n A 1 179 HIS 179 181 181 HIS HIS A . n A 1 180 TYR 180 182 182 TYR TYR A . n A 1 181 GLN 181 183 183 GLN GLN A . n A 1 182 GLN 182 184 184 GLN GLN A . n A 1 183 ASN 183 185 185 ASN ASN A . n A 1 184 THR 184 186 186 THR THR A . n A 1 185 PRO 185 187 187 PRO PRO A . n A 1 186 ILE 186 188 188 ILE ILE A . n A 1 187 GLY 187 189 189 GLY GLY A . n A 1 188 ASP 188 190 190 ASP ASP A . n A 1 189 GLY 189 191 191 GLY GLY A . n A 1 190 PRO 190 192 192 PRO PRO A . n A 1 191 VAL 191 193 193 VAL VAL A . n A 1 192 LEU 192 194 194 LEU LEU A . n A 1 193 LEU 193 195 195 LEU LEU A . n A 1 194 PRO 194 196 196 PRO PRO A . n A 1 195 ASP 195 197 197 ASP ASP A . n A 1 196 ASN 196 198 198 ASN ASN A . n A 1 197 HIS 197 199 199 HIS HIS A . n A 1 198 TYR 198 200 200 TYR TYR A . n A 1 199 LEU 199 201 201 LEU LEU A . n A 1 200 SER 200 202 202 SER SER A . n A 1 201 THR 201 203 203 THR THR A . n A 1 202 GLN 202 204 204 GLN GLN A . n A 1 203 SER 203 205 205 SER SER A . n A 1 204 ALA 204 206 206 ALA ALA A . n A 1 205 LEU 205 207 207 LEU LEU A . n A 1 206 SER 206 208 208 SER SER A . n A 1 207 LYS 207 209 209 LYS LYS A . n A 1 208 ASP 208 210 210 ASP ASP A . n A 1 209 PRO 209 211 211 PRO PRO A . n A 1 210 ASN 210 212 212 ASN ASN A . n A 1 211 GLU 211 213 213 GLU GLU A . n A 1 212 LYS 212 214 214 LYS LYS A . n A 1 213 ARG 213 215 215 ARG ARG A . n A 1 214 ASP 214 216 216 ASP ASP A . n A 1 215 HIS 215 217 217 HIS HIS A . n A 1 216 MET 216 218 218 MET MET A . n A 1 217 VAL 217 219 219 VAL VAL A . n A 1 218 LEU 218 220 220 LEU LEU A . n A 1 219 LEU 219 221 221 LEU LEU A . n A 1 220 GLU 220 222 222 GLU GLU A . n A 1 221 PHE 221 223 223 PHE PHE A . n A 1 222 VAL 222 224 224 VAL VAL A . n A 1 223 THR 223 225 225 THR THR A . n A 1 224 ALA 224 226 226 ALA ALA A . n A 1 225 ALA 225 227 227 ALA ALA A . n A 1 226 GLY 226 228 228 GLY GLY A . n A 1 227 ILE 227 229 229 ILE ILE A . n A 1 228 THR 228 230 ? ? ? A . n A 1 229 HIS 229 231 ? ? ? A . n A 1 230 GLY 230 232 ? ? ? A . n A 1 231 MET 231 233 ? ? ? A . n A 1 232 ASP 232 234 ? ? ? A . n A 1 233 GLU 233 235 ? ? ? A . n A 1 234 LEU 234 236 ? ? ? A . n A 1 235 TYR 235 237 ? ? ? A . n A 1 236 LYS 236 238 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 239 1 HOH HOH A . B 2 HOH 2 240 2 HOH HOH A . B 2 HOH 3 241 3 HOH HOH A . B 2 HOH 4 242 4 HOH HOH A . B 2 HOH 5 243 5 HOH HOH A . B 2 HOH 6 244 6 HOH HOH A . B 2 HOH 7 245 7 HOH HOH A . B 2 HOH 8 246 8 HOH HOH A . B 2 HOH 9 247 9 HOH HOH A . B 2 HOH 10 248 10 HOH HOH A . B 2 HOH 11 249 11 HOH HOH A . B 2 HOH 12 250 12 HOH HOH A . B 2 HOH 13 251 13 HOH HOH A . B 2 HOH 14 252 14 HOH HOH A . B 2 HOH 15 253 15 HOH HOH A . B 2 HOH 16 254 16 HOH HOH A . B 2 HOH 17 255 17 HOH HOH A . B 2 HOH 18 256 18 HOH HOH A . B 2 HOH 19 257 19 HOH HOH A . B 2 HOH 20 258 20 HOH HOH A . B 2 HOH 21 259 21 HOH HOH A . B 2 HOH 22 260 22 HOH HOH A . B 2 HOH 23 261 23 HOH HOH A . B 2 HOH 24 262 24 HOH HOH A . B 2 HOH 25 263 25 HOH HOH A . B 2 HOH 26 264 26 HOH HOH A . B 2 HOH 27 265 27 HOH HOH A . B 2 HOH 28 266 28 HOH HOH A . B 2 HOH 29 267 29 HOH HOH A . B 2 HOH 30 268 30 HOH HOH A . B 2 HOH 31 269 31 HOH HOH A . B 2 HOH 32 270 32 HOH HOH A . B 2 HOH 33 271 33 HOH HOH A . B 2 HOH 34 272 34 HOH HOH A . B 2 HOH 35 273 35 HOH HOH A . B 2 HOH 36 274 36 HOH HOH A . B 2 HOH 37 275 37 HOH HOH A . B 2 HOH 38 276 38 HOH HOH A . B 2 HOH 39 277 39 HOH HOH A . B 2 HOH 40 278 40 HOH HOH A . B 2 HOH 41 279 41 HOH HOH A . B 2 HOH 42 280 42 HOH HOH A . B 2 HOH 43 281 43 HOH HOH A . B 2 HOH 44 282 44 HOH HOH A . B 2 HOH 45 283 45 HOH HOH A . B 2 HOH 46 284 46 HOH HOH A . B 2 HOH 47 285 47 HOH HOH A . B 2 HOH 48 286 48 HOH HOH A . B 2 HOH 49 287 49 HOH HOH A . B 2 HOH 50 288 50 HOH HOH A . B 2 HOH 51 289 51 HOH HOH A . B 2 HOH 52 290 52 HOH HOH A . B 2 HOH 53 291 53 HOH HOH A . B 2 HOH 54 292 54 HOH HOH A . B 2 HOH 55 293 55 HOH HOH A . B 2 HOH 56 294 56 HOH HOH A . B 2 HOH 57 295 57 HOH HOH A . B 2 HOH 58 296 58 HOH HOH A . B 2 HOH 59 297 59 HOH HOH A . B 2 HOH 60 298 60 HOH HOH A . B 2 HOH 61 299 61 HOH HOH A . B 2 HOH 62 300 62 HOH HOH A . B 2 HOH 63 301 63 HOH HOH A . B 2 HOH 64 302 64 HOH HOH A . B 2 HOH 65 303 65 HOH HOH A . B 2 HOH 66 304 66 HOH HOH A . B 2 HOH 67 305 67 HOH HOH A . B 2 HOH 68 306 68 HOH HOH A . B 2 HOH 69 307 69 HOH HOH A . B 2 HOH 70 308 70 HOH HOH A . B 2 HOH 71 309 71 HOH HOH A . B 2 HOH 72 310 72 HOH HOH A . B 2 HOH 73 311 73 HOH HOH A . B 2 HOH 74 312 74 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CRO 65 A CRO 66 ? GLY ? 2 A CRO 65 A CRO 66 ? TYR ? 3 A CRO 65 A CRO 66 ? GLY ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-06-16 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_initial_refinement_model 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 9 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 14 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal TNT refinement . ? 1 MOSFLM 'data reduction' . ? 2 CCP4 'data scaling' . ? 3 TNT phasing . ? 4 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 90 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 90 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.324 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation 0.072 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 19 ? ? CG A ASP 19 ? ? OD1 A ASP 19 ? ? 123.98 118.30 5.68 0.90 N 2 1 CB A ASP 19 ? ? CG A ASP 19 ? ? OD2 A ASP 19 ? ? 111.91 118.30 -6.39 0.90 N 3 1 CB A ASP 21 ? ? CG A ASP 21 ? ? OD1 A ASP 21 ? ? 125.07 118.30 6.77 0.90 N 4 1 CB A ASP 21 ? ? CG A ASP 21 ? ? OD2 A ASP 21 ? ? 112.06 118.30 -6.24 0.90 N 5 1 CB A ASP 76 ? ? CG A ASP 76 ? ? OD1 A ASP 76 ? ? 123.93 118.30 5.63 0.90 N 6 1 CB A ASP 76 ? ? CG A ASP 76 ? ? OD2 A ASP 76 ? ? 112.05 118.30 -6.25 0.90 N 7 1 CB A ASP 82 ? ? CG A ASP 82 ? ? OD2 A ASP 82 ? ? 112.80 118.30 -5.50 0.90 N 8 1 CB A ASP 117 ? B CG A ASP 117 ? B OD1 A ASP 117 ? B 123.78 118.30 5.48 0.90 N 9 1 CB A ASP 117 ? A CG A ASP 117 ? A OD2 A ASP 117 ? A 112.44 118.30 -5.86 0.90 N 10 1 CB A ASP 117 ? B CG A ASP 117 ? B OD2 A ASP 117 ? B 112.00 118.30 -6.30 0.90 N 11 1 CB A ASP 180 ? ? CG A ASP 180 ? ? OD2 A ASP 180 ? ? 112.25 118.30 -6.05 0.90 N 12 1 CB A ASP 210 ? ? CG A ASP 210 ? ? OD1 A ASP 210 ? ? 123.87 118.30 5.57 0.90 N 13 1 CB A ASP 210 ? ? CG A ASP 210 ? ? OD2 A ASP 210 ? ? 112.50 118.30 -5.80 0.90 N 14 1 CB A ASP 216 ? ? CG A ASP 216 ? ? OD2 A ASP 216 ? ? 112.54 118.30 -5.76 0.90 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ILE _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 136 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -74.90 _pdbx_validate_torsion.psi -72.60 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CB1 _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id CRO _pdbx_validate_chiral.auth_seq_id 66 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 0 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id CRO _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 66 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id CG1 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id CRO _pdbx_unobs_or_zero_occ_atoms.label_seq_id 65 _pdbx_unobs_or_zero_occ_atoms.label_atom_id CG1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 230 ? A THR 228 3 1 Y 1 A HIS 231 ? A HIS 229 4 1 Y 1 A GLY 232 ? A GLY 230 5 1 Y 1 A MET 233 ? A MET 231 6 1 Y 1 A ASP 234 ? A ASP 232 7 1 Y 1 A GLU 235 ? A GLU 233 8 1 Y 1 A LEU 236 ? A LEU 234 9 1 Y 1 A TYR 237 ? A TYR 235 10 1 Y 1 A LYS 238 ? A LYS 236 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1EMA _pdbx_initial_refinement_model.details 'PDB ENTRY 1EMA' #