data_1ESK # _entry.id 1ESK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ESK pdb_00001esk 10.2210/pdb1esk/pdb RCSB RCSB010857 ? ? WWPDB D_1000010857 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1BJ6 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ESK _pdbx_database_status.recvd_initial_deposition_date 2000-04-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Morellet, N.' 1 'Demene, H.' 2 'Teilleux, V.' 3 'Huynh-Dinh, T.' 4 'de Rocquigny, H.' 5 'Fournie-Zaluski, M.-C.' 6 'Roques, B.P.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution Structure of (12-53)NCp7 of HIV-1' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Conformational Behaviour of the Active and Inactive Forms of the Nucleocapsid NCp7 of HIV-1 Studied by 1H NMR.' J.Mol.Biol. 235 287 301 1994 JMOBAK UK 0022-2836 0070 ? ? ? 2 'Structure of the Complex Between the HIV-1 Nucleocapsid Protein and the Single-stranded Pentanucleotide d(ACGCC).' J.Mol.Biol. 283 419 434 1998 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.1998.2098 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Morellet, N.' 1 ? primary 'Demene, H.' 2 ? primary 'Teilleux, V.' 3 ? primary 'Huynh-Dinh, T.' 4 ? primary 'de Rocquigny, H.' 5 ? primary 'Fournie-Zaluski, M.-C.' 6 ? primary 'Roques, B.P.' 7 ? 1 'Morellet, N.' 8 ? 1 'de Roquigny, H.' 9 ? 1 'Mely, Y.' 10 ? 1 'Jullian, N.' 11 ? 1 'Demene, H.' 12 ? 1 'Ottmann, M.' 13 ? 1 'Gerard, D.' 14 ? 1 'Darlix, J.L.' 15 ? 1 'Fournie-Zaluski, M.C.' 16 ? 1 'Roques, B.P.' 17 ? 2 'Morellet, N.' 18 ? 2 'Demene, H.' 19 ? 2 'Teilleux, V.' 20 ? 2 'Huynh-Dinh, T.' 21 ? 2 'de Roquigny, H.' 22 ? 2 'Fournie-Zaluski, M.C.' 23 ? 2 'Roques, B.P.' 24 ? # _cell.entry_id 1ESK _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ESK _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'GAG POLYPROTEIN' 4837.642 1 ? ? 'RESIDUES 12-53' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NUCLEOCAPSID PROTEIN NCP7' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQ _entity_poly.pdbx_seq_one_letter_code_can NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 VAL n 1 3 LYS n 1 4 CYS n 1 5 PHE n 1 6 ASN n 1 7 CYS n 1 8 GLY n 1 9 LYS n 1 10 GLU n 1 11 GLY n 1 12 HIS n 1 13 THR n 1 14 ALA n 1 15 ARG n 1 16 ASN n 1 17 CYS n 1 18 ARG n 1 19 ALA n 1 20 PRO n 1 21 ARG n 1 22 LYS n 1 23 LYS n 1 24 GLY n 1 25 CYS n 1 26 TRP n 1 27 LYS n 1 28 CYS n 1 29 GLY n 1 30 LYS n 1 31 GLU n 1 32 GLY n 1 33 HIS n 1 34 GLN n 1 35 MET n 1 36 LYS n 1 37 ASP n 1 38 CYS n 1 39 THR n 1 40 GLU n 1 41 ARG n 1 42 GLN n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'The protein was chemically synthesized. The sequence is naturally found in human immunodeficiency virus type 1 (HIV-1).' # _struct_ref.id 1 _struct_ref.db_code POL_HV1H2 _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04585 _struct_ref.pdbx_align_begin 388 _struct_ref.pdbx_seq_one_letter_code IVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQ _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ESK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 42 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04585 _struct_ref_seq.db_align_beg 388 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 429 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 12 _struct_ref_seq.pdbx_auth_seq_align_end 53 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1ESK _struct_ref_seq_dif.mon_id ASN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P04585 _struct_ref_seq_dif.db_mon_id ILE _struct_ref_seq_dif.pdbx_seq_db_seq_num 388 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 12 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 DQF-COSY 3 1 1 TOCSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength n.a. _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2mM (12-53)NCp7, 90%H2O, 10% D2O, pH 6.0' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AMX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1ESK _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'the structures are based on a total of 444 NOE-derived distance constraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1ESK _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1ESK _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 9 _pdbx_nmr_ensemble.conformer_selection_criteria ;structures with acceptable covalent geometry,structures with favorable non-bond energy,structures with the least restraint violations,structures with the lowest energy ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1ESK _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal UXNMR 940501 collection Bruker 1 Discover ? refinement MSI 2 # _exptl.entry_id 1ESK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ESK _struct.title 'SOLUTION STRUCTURE OF NCP7 FROM HIV-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ESK _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text '(12-53)NCp7, HIV-1, PROTEIN, Viral protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 4 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 15 A ZN 54 1_555 ? ? ? ? ? ? ? 2.252 ? ? metalc2 metalc ? ? A CYS 7 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 54 1_555 ? ? ? ? ? ? ? 2.220 ? ? metalc3 metalc ? ? A HIS 12 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 23 A ZN 54 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc4 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 54 1_555 ? ? ? ? ? ? ? 2.236 ? ? metalc5 metalc ? ? A CYS 25 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 36 A ZN 55 1_555 ? ? ? ? ? ? ? 2.248 ? ? metalc6 metalc ? ? A CYS 28 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 39 A ZN 55 1_555 ? ? ? ? ? ? ? 2.226 ? ? metalc7 metalc ? ? A HIS 33 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 44 A ZN 55 1_555 ? ? ? ? ? ? ? 2.026 ? ? metalc8 metalc ? ? A CYS 38 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 49 A ZN 55 1_555 ? ? ? ? ? ? ? 2.185 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 54 ? 4 'BINDING SITE FOR RESIDUE ZN A 54' AC2 Software A ZN 55 ? 5 'BINDING SITE FOR RESIDUE ZN A 55' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 4 ? CYS A 15 . ? 1_555 ? 2 AC1 4 CYS A 7 ? CYS A 18 . ? 1_555 ? 3 AC1 4 HIS A 12 ? HIS A 23 . ? 1_555 ? 4 AC1 4 CYS A 17 ? CYS A 28 . ? 1_555 ? 5 AC2 5 CYS A 25 ? CYS A 36 . ? 1_555 ? 6 AC2 5 CYS A 28 ? CYS A 39 . ? 1_555 ? 7 AC2 5 HIS A 33 ? HIS A 44 . ? 1_555 ? 8 AC2 5 CYS A 38 ? CYS A 49 . ? 1_555 ? 9 AC2 5 GLU A 40 ? GLU A 51 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ESK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ESK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 12 12 ASN ASN A . n A 1 2 VAL 2 13 13 VAL VAL A . n A 1 3 LYS 3 14 14 LYS LYS A . n A 1 4 CYS 4 15 15 CYS CYS A . n A 1 5 PHE 5 16 16 PHE PHE A . n A 1 6 ASN 6 17 17 ASN ASN A . n A 1 7 CYS 7 18 18 CYS CYS A . n A 1 8 GLY 8 19 19 GLY GLY A . n A 1 9 LYS 9 20 20 LYS LYS A . n A 1 10 GLU 10 21 21 GLU GLU A . n A 1 11 GLY 11 22 22 GLY GLY A . n A 1 12 HIS 12 23 23 HIS HIS A . n A 1 13 THR 13 24 24 THR THR A . n A 1 14 ALA 14 25 25 ALA ALA A . n A 1 15 ARG 15 26 26 ARG ARG A . n A 1 16 ASN 16 27 27 ASN ASN A . n A 1 17 CYS 17 28 28 CYS CYS A . n A 1 18 ARG 18 29 29 ARG ARG A . n A 1 19 ALA 19 30 30 ALA ALA A . n A 1 20 PRO 20 31 31 PRO PRO A . n A 1 21 ARG 21 32 32 ARG ARG A . n A 1 22 LYS 22 33 33 LYS LYS A . n A 1 23 LYS 23 34 34 LYS LYS A . n A 1 24 GLY 24 35 35 GLY GLY A . n A 1 25 CYS 25 36 36 CYS CYS A . n A 1 26 TRP 26 37 37 TRP TRP A . n A 1 27 LYS 27 38 38 LYS LYS A . n A 1 28 CYS 28 39 39 CYS CYS A . n A 1 29 GLY 29 40 40 GLY GLY A . n A 1 30 LYS 30 41 41 LYS LYS A . n A 1 31 GLU 31 42 42 GLU GLU A . n A 1 32 GLY 32 43 43 GLY GLY A . n A 1 33 HIS 33 44 44 HIS HIS A . n A 1 34 GLN 34 45 45 GLN GLN A . n A 1 35 MET 35 46 46 MET MET A . n A 1 36 LYS 36 47 47 LYS LYS A . n A 1 37 ASP 37 48 48 ASP ASP A . n A 1 38 CYS 38 49 49 CYS CYS A . n A 1 39 THR 39 50 50 THR THR A . n A 1 40 GLU 40 51 51 GLU GLU A . n A 1 41 ARG 41 52 52 ARG ARG A . n A 1 42 GLN 42 53 53 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 54 54 ZN ZIN A . C 2 ZN 1 55 55 ZN ZIN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 4 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 54 ? 1_555 SG ? A CYS 7 ? A CYS 18 ? 1_555 112.7 ? 2 SG ? A CYS 4 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 54 ? 1_555 NE2 ? A HIS 12 ? A HIS 23 ? 1_555 105.2 ? 3 SG ? A CYS 7 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 54 ? 1_555 NE2 ? A HIS 12 ? A HIS 23 ? 1_555 109.4 ? 4 SG ? A CYS 4 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 54 ? 1_555 SG ? A CYS 17 ? A CYS 28 ? 1_555 109.0 ? 5 SG ? A CYS 7 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 54 ? 1_555 SG ? A CYS 17 ? A CYS 28 ? 1_555 110.5 ? 6 NE2 ? A HIS 12 ? A HIS 23 ? 1_555 ZN ? B ZN . ? A ZN 54 ? 1_555 SG ? A CYS 17 ? A CYS 28 ? 1_555 109.8 ? 7 SG ? A CYS 25 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 55 ? 1_555 SG ? A CYS 28 ? A CYS 39 ? 1_555 112.4 ? 8 SG ? A CYS 25 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 55 ? 1_555 NE2 ? A HIS 33 ? A HIS 44 ? 1_555 108.6 ? 9 SG ? A CYS 28 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 55 ? 1_555 NE2 ? A HIS 33 ? A HIS 44 ? 1_555 109.9 ? 10 SG ? A CYS 25 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 55 ? 1_555 SG ? A CYS 38 ? A CYS 49 ? 1_555 106.5 ? 11 SG ? A CYS 28 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 55 ? 1_555 SG ? A CYS 38 ? A CYS 49 ? 1_555 113.3 ? 12 NE2 ? A HIS 33 ? A HIS 44 ? 1_555 ZN ? C ZN . ? A ZN 55 ? 1_555 SG ? A CYS 38 ? A CYS 49 ? 1_555 105.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-04-26 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_ref_seq_dif.details' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A ALA 30 ? ? N A PRO 31 ? ? CD A PRO 31 ? ? 113.20 128.40 -15.20 2.10 Y 2 3 C A ALA 30 ? ? N A PRO 31 ? ? CD A PRO 31 ? ? 113.90 128.40 -14.50 2.10 Y 3 7 CB A CYS 15 ? ? CA A CYS 15 ? ? C A CYS 15 ? ? 118.82 111.50 7.32 1.20 N 4 8 C A ALA 30 ? ? N A PRO 31 ? ? CD A PRO 31 ? ? 113.37 128.40 -15.03 2.10 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 17 ? ? -54.39 -83.58 2 1 ARG A 29 ? ? -111.20 56.40 3 1 PRO A 31 ? ? 40.77 164.95 4 1 LYS A 38 ? ? -121.43 -60.13 5 1 HIS A 44 ? ? 151.89 168.23 6 2 PRO A 31 ? ? 32.76 178.63 7 3 VAL A 13 ? ? -35.98 135.04 8 3 ASN A 17 ? ? -57.68 -84.46 9 3 ARG A 29 ? ? -114.28 55.76 10 3 PRO A 31 ? ? 40.37 173.00 11 3 HIS A 44 ? ? 149.81 163.97 12 4 GLU A 21 ? ? 55.52 171.33 13 4 PRO A 31 ? ? 31.76 176.03 14 5 CYS A 18 ? ? -131.63 -43.39 15 5 GLU A 21 ? ? 74.91 171.55 16 5 PRO A 31 ? ? 34.41 170.47 17 5 LYS A 38 ? ? -101.42 -60.93 18 5 HIS A 44 ? ? 146.95 165.22 19 6 PRO A 31 ? ? 33.84 174.59 20 6 LYS A 38 ? ? -103.17 -62.59 21 6 HIS A 44 ? ? 153.75 162.22 22 6 ARG A 52 ? ? -88.07 46.08 23 7 VAL A 13 ? ? -35.72 135.03 24 7 PRO A 31 ? ? 32.99 176.58 25 7 LYS A 38 ? ? -106.46 -63.87 26 7 HIS A 44 ? ? 151.29 160.19 27 7 ARG A 52 ? ? -154.15 36.86 28 8 ASN A 17 ? ? -52.26 -80.27 29 8 ARG A 29 ? ? -110.25 58.43 30 8 PRO A 31 ? ? 40.18 165.49 31 8 THR A 50 ? ? -96.15 -75.69 32 8 GLU A 51 ? ? -167.65 32.86 33 9 VAL A 13 ? ? -36.94 135.28 34 9 CYS A 18 ? ? -136.26 -35.63 35 9 GLU A 21 ? ? 64.55 167.65 36 9 PRO A 31 ? ? 36.47 169.80 37 9 GLU A 42 ? ? -145.97 -4.14 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 4 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 52 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.079 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #