data_1EV8 # _entry.id 1EV8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.357 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1EV8 pdb_00001ev8 10.2210/pdb1ev8/pdb RCSB RCSB010923 ? ? WWPDB D_1000010923 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1EV5 'S167A MUTANT of E. coli Thymidylate Synthase (modified catalytic cysteine)' unspecified PDB 1EVF 'S167T MUTANT of E. coli Thymidylate Synthase (modified catalytic cysteine)' unspecified PDB 1EVG 'S167T MUTANT of E. coli Thymidylate Synthase (unmodified catalytic cysteine)' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EV8 _pdbx_database_status.recvd_initial_deposition_date 2000-04-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Phan, J.' 1 ? 'Mahdavian, E.' 2 ? 'Nivens, M.C.' 3 ? 'Minor, W.' 4 0000-0001-7075-7090 'Berger, S.' 5 ? 'Spencer, H.T.' 6 ? 'Dunlap, R.B.' 7 ? 'Lebioda, L.' 8 ? # _citation.id primary _citation.title 'Catalytic cysteine of thymidylate synthase is activated upon substrate binding.' _citation.journal_abbrev Biochemistry _citation.journal_volume 39 _citation.page_first 6969 _citation.page_last 6978 _citation.year 2000 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10841779 _citation.pdbx_database_id_DOI 10.1021/bi000367g # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Phan, J.' 1 ? primary 'Mahdavian, E.' 2 ? primary 'Nivens, M.C.' 3 ? primary 'Minor, W.' 4 0000-0001-7075-7090 primary 'Berger, S.' 5 ? primary 'Spencer, H.T.' 6 ? primary 'Dunlap, R.B.' 7 ? primary 'Lebioda, L.' 8 ? # _cell.entry_id 1EV8 _cell.length_a 136.274 _cell.length_b 136.274 _cell.length_c 136.274 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EV8 _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'THYMIDYLATE SYNTHASE' 30880.197 1 2.1.1.45 S167C ? ? 2 water nat water 18.015 11 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(CXM)KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKR(CME)HLRSIIHELLWFLQGDTNIAYL HENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAP(CME)HA FFQFYVADGKLSCQLYQRC(CME)DVFLGLPFNIASYALLVHMMAQQ(CME)DLEVGDFVWTGGDTHLYSNHMDQTHLQL SREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI ; _entity_poly.pdbx_seq_one_letter_code_can ;MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIW DEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLS CQLYQRCCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF DYRFEDFEIEGYDPHPGIKAPVAI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CXM n 1 2 LYS n 1 3 GLN n 1 4 TYR n 1 5 LEU n 1 6 GLU n 1 7 LEU n 1 8 MET n 1 9 GLN n 1 10 LYS n 1 11 VAL n 1 12 LEU n 1 13 ASP n 1 14 GLU n 1 15 GLY n 1 16 THR n 1 17 GLN n 1 18 LYS n 1 19 ASN n 1 20 ASP n 1 21 ARG n 1 22 THR n 1 23 GLY n 1 24 THR n 1 25 GLY n 1 26 THR n 1 27 LEU n 1 28 SER n 1 29 ILE n 1 30 PHE n 1 31 GLY n 1 32 HIS n 1 33 GLN n 1 34 MET n 1 35 ARG n 1 36 PHE n 1 37 ASN n 1 38 LEU n 1 39 GLN n 1 40 ASP n 1 41 GLY n 1 42 PHE n 1 43 PRO n 1 44 LEU n 1 45 VAL n 1 46 THR n 1 47 THR n 1 48 LYS n 1 49 ARG n 1 50 CME n 1 51 HIS n 1 52 LEU n 1 53 ARG n 1 54 SER n 1 55 ILE n 1 56 ILE n 1 57 HIS n 1 58 GLU n 1 59 LEU n 1 60 LEU n 1 61 TRP n 1 62 PHE n 1 63 LEU n 1 64 GLN n 1 65 GLY n 1 66 ASP n 1 67 THR n 1 68 ASN n 1 69 ILE n 1 70 ALA n 1 71 TYR n 1 72 LEU n 1 73 HIS n 1 74 GLU n 1 75 ASN n 1 76 ASN n 1 77 VAL n 1 78 THR n 1 79 ILE n 1 80 TRP n 1 81 ASP n 1 82 GLU n 1 83 TRP n 1 84 ALA n 1 85 ASP n 1 86 GLU n 1 87 ASN n 1 88 GLY n 1 89 ASP n 1 90 LEU n 1 91 GLY n 1 92 PRO n 1 93 VAL n 1 94 TYR n 1 95 GLY n 1 96 LYS n 1 97 GLN n 1 98 TRP n 1 99 ARG n 1 100 ALA n 1 101 TRP n 1 102 PRO n 1 103 THR n 1 104 PRO n 1 105 ASP n 1 106 GLY n 1 107 ARG n 1 108 HIS n 1 109 ILE n 1 110 ASP n 1 111 GLN n 1 112 ILE n 1 113 THR n 1 114 THR n 1 115 VAL n 1 116 LEU n 1 117 ASN n 1 118 GLN n 1 119 LEU n 1 120 LYS n 1 121 ASN n 1 122 ASP n 1 123 PRO n 1 124 ASP n 1 125 SER n 1 126 ARG n 1 127 ARG n 1 128 ILE n 1 129 ILE n 1 130 VAL n 1 131 SER n 1 132 ALA n 1 133 TRP n 1 134 ASN n 1 135 VAL n 1 136 GLY n 1 137 GLU n 1 138 LEU n 1 139 ASP n 1 140 LYS n 1 141 MET n 1 142 ALA n 1 143 LEU n 1 144 ALA n 1 145 PRO n 1 146 CME n 1 147 HIS n 1 148 ALA n 1 149 PHE n 1 150 PHE n 1 151 GLN n 1 152 PHE n 1 153 TYR n 1 154 VAL n 1 155 ALA n 1 156 ASP n 1 157 GLY n 1 158 LYS n 1 159 LEU n 1 160 SER n 1 161 CYS n 1 162 GLN n 1 163 LEU n 1 164 TYR n 1 165 GLN n 1 166 ARG n 1 167 CYS n 1 168 CME n 1 169 ASP n 1 170 VAL n 1 171 PHE n 1 172 LEU n 1 173 GLY n 1 174 LEU n 1 175 PRO n 1 176 PHE n 1 177 ASN n 1 178 ILE n 1 179 ALA n 1 180 SER n 1 181 TYR n 1 182 ALA n 1 183 LEU n 1 184 LEU n 1 185 VAL n 1 186 HIS n 1 187 MET n 1 188 MET n 1 189 ALA n 1 190 GLN n 1 191 GLN n 1 192 CME n 1 193 ASP n 1 194 LEU n 1 195 GLU n 1 196 VAL n 1 197 GLY n 1 198 ASP n 1 199 PHE n 1 200 VAL n 1 201 TRP n 1 202 THR n 1 203 GLY n 1 204 GLY n 1 205 ASP n 1 206 THR n 1 207 HIS n 1 208 LEU n 1 209 TYR n 1 210 SER n 1 211 ASN n 1 212 HIS n 1 213 MET n 1 214 ASP n 1 215 GLN n 1 216 THR n 1 217 HIS n 1 218 LEU n 1 219 GLN n 1 220 LEU n 1 221 SER n 1 222 ARG n 1 223 GLU n 1 224 PRO n 1 225 ARG n 1 226 PRO n 1 227 LEU n 1 228 PRO n 1 229 LYS n 1 230 LEU n 1 231 ILE n 1 232 ILE n 1 233 LYS n 1 234 ARG n 1 235 LYS n 1 236 PRO n 1 237 GLU n 1 238 SER n 1 239 ILE n 1 240 PHE n 1 241 ASP n 1 242 TYR n 1 243 ARG n 1 244 PHE n 1 245 GLU n 1 246 ASP n 1 247 PHE n 1 248 GLU n 1 249 ILE n 1 250 GLU n 1 251 GLY n 1 252 TYR n 1 253 ASP n 1 254 PRO n 1 255 HIS n 1 256 PRO n 1 257 GLY n 1 258 ILE n 1 259 LYS n 1 260 ALA n 1 261 PRO n 1 262 VAL n 1 263 ALA n 1 264 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PBLUESCRIPT SK' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code TYSY_ECOLI _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0A884 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIW DEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLS CQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF DYRFEDFEIEGYDPHPGIKAPVAI ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EV8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 264 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A884 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 264 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 264 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1EV8 CXM A 1 ? UNP P0A884 MET 1 'modified residue' 1 1 1 1EV8 CME A 50 ? UNP P0A884 CYS 50 'modified residue' 50 2 1 1EV8 CME A 146 ? UNP P0A884 CYS 146 'modified residue' 146 3 1 1EV8 CYS A 167 ? UNP P0A884 SER 167 'engineered mutation' 167 4 1 1EV8 CME A 168 ? UNP P0A884 CYS 168 'modified residue' 168 5 1 1EV8 CME A 192 ? UNP P0A884 CYS 192 'modified residue' 192 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ? 'C5 H11 N O3 S2' 197.276 CXM 'L-peptide linking' n N-CARBOXYMETHIONINE ? 'C6 H11 N O4 S' 193.221 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1EV8 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 63.96 _exptl_crystal.density_Matthews 3.41 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.temp 291.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '68% saturated ammonium sulfate, 100 mM sodium phosphate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 18K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS' _diffrn_detector.pdbx_collection_date 1998-11-25 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1EV8 _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F 3.0 _reflns.d_resolution_low 6.0 _reflns.d_resolution_high 2.6 _reflns.number_obs 11099 _reflns.number_all 11991 _reflns.percent_possible_obs 92.6 _reflns.pdbx_Rmerge_I_obs 0.1250000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 17.05 _reflns.B_iso_Wilson_estimate 11.0 _reflns.pdbx_redundancy 12.27 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 31.7 _reflns_shell.Rmerge_I_obs 0.5500000 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy ? _reflns_shell.number_unique_all 410 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1EV8 _refine.ls_number_reflns_obs 9684 _refine.ls_number_reflns_all 11099 _refine.pdbx_ls_sigma_I 1.0 _refine.pdbx_ls_sigma_F 3.0 _refine.pdbx_data_cutoff_high_absF 2336470.49 _refine.pdbx_data_cutoff_low_absF 0.00 _refine.ls_d_res_low 6.00 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 81.4 _refine.ls_R_factor_obs 0.2230000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2230000 _refine.ls_R_factor_R_free 0.2640000 _refine.ls_R_factor_R_free_error 0.008 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.1 _refine.ls_number_reflns_R_free 979 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 25.1 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 1.113 _refine.solvent_model_param_bsol 137.4 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1EV8 _refine_analyze.Luzzati_coordinate_error_obs 0.33 _refine_analyze.Luzzati_sigma_a_obs 0.36 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.42 _refine_analyze.Luzzati_sigma_a_free 0.45 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2164 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 2175 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 6.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.6 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.5 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.92 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.60 _refine_ls_shell.d_res_low 2.75 _refine_ls_shell.number_reflns_R_work 623 _refine_ls_shell.R_factor_R_work 0.2570000 _refine_ls_shell.percent_reflns_obs 35.3 _refine_ls_shell.R_factor_R_free 0.2940000 _refine_ls_shell.R_factor_R_free_error 0.034 _refine_ls_shell.percent_reflns_R_free 10.9 _refine_ls_shell.number_reflns_R_free 76 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1EV8 _struct.title 'CRYSTAL STRUCTURE ANALYSIS OF CYS167 MUTANT OF ESCHERICHIA COLI' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EV8 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'Cys167 E. coli Thymidylate Synthase, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 2 ? GLY A 15 ? LYS A 2 GLY A 15 1 ? 14 HELX_P HELX_P2 2 GLN A 39 ? GLY A 41 ? GLN A 39 GLY A 41 5 ? 3 HELX_P HELX_P3 3 LEU A 52 ? GLN A 64 ? LEU A 52 GLN A 64 1 ? 13 HELX_P HELX_P4 4 ILE A 69 ? ASN A 75 ? ILE A 69 ASN A 75 1 ? 7 HELX_P HELX_P5 5 TRP A 80 ? ALA A 84 ? TRP A 80 ALA A 84 5 ? 5 HELX_P HELX_P6 6 VAL A 93 ? ALA A 100 ? VAL A 93 ALA A 100 1 ? 8 HELX_P HELX_P7 7 ASP A 110 ? ASP A 122 ? ASP A 110 ASP A 122 1 ? 13 HELX_P HELX_P8 8 ASN A 134 ? MET A 141 ? ASN A 134 MET A 141 5 ? 8 HELX_P HELX_P9 9 GLY A 173 ? GLN A 191 ? GLY A 173 GLN A 191 1 ? 19 HELX_P HELX_P10 10 HIS A 212 ? LEU A 220 ? HIS A 212 LEU A 220 1 ? 9 HELX_P HELX_P11 11 ARG A 243 ? GLU A 245 ? ARG A 243 GLU A 245 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A CXM 1 C ? ? ? 1_555 A LYS 2 N ? ? A CXM 1 A LYS 2 1_555 ? ? ? ? ? ? ? 1.349 ? ? covale2 covale both ? A ARG 49 C ? ? ? 1_555 A CME 50 N ? ? A ARG 49 A CME 50 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale3 covale both ? A CME 50 C ? ? ? 1_555 A HIS 51 N ? ? A CME 50 A HIS 51 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A PRO 145 C ? ? ? 1_555 A CME 146 N ? ? A PRO 145 A CME 146 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale5 covale both ? A CME 146 C ? ? ? 1_555 A HIS 147 N ? ? A CME 146 A HIS 147 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A CYS 167 C ? ? ? 1_555 A CME 168 N ? ? A CYS 167 A CME 168 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale7 covale both ? A CME 168 C ? ? ? 1_555 A ASP 169 N ? ? A CME 168 A ASP 169 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale8 covale both ? A GLN 191 C ? ? ? 1_555 A CME 192 N ? ? A GLN 191 A CME 192 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale9 covale both ? A CME 192 C ? ? ? 1_555 A ASP 193 N ? ? A CME 192 A ASP 193 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 16 ? ASN A 19 ? THR A 16 ASN A 19 A 2 GLY A 25 ? ASN A 37 ? GLY A 25 ASN A 37 A 3 GLU A 195 ? TYR A 209 ? GLU A 195 TYR A 209 A 4 LYS A 158 ? GLN A 165 ? LYS A 158 GLN A 165 A 5 PHE A 149 ? ALA A 155 ? PHE A 149 ALA A 155 A 6 ILE A 129 ? SER A 131 ? ILE A 129 SER A 131 B 1 TRP A 101 ? PRO A 102 ? TRP A 101 PRO A 102 B 2 HIS A 108 ? ILE A 109 ? HIS A 108 ILE A 109 C 1 LYS A 229 ? ILE A 232 ? LYS A 229 ILE A 232 C 2 PHE A 247 ? GLU A 250 ? PHE A 247 GLU A 250 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 18 ? O LYS A 18 N THR A 26 ? N THR A 26 A 2 3 N PHE A 36 ? N PHE A 36 O PHE A 199 ? O PHE A 199 A 3 4 N GLY A 197 ? N GLY A 197 O LEU A 159 ? O LEU A 159 A 4 5 N TYR A 164 ? N TYR A 164 O PHE A 149 ? O PHE A 149 A 5 6 O PHE A 150 ? O PHE A 150 N VAL A 130 ? N VAL A 130 B 1 2 O TRP A 101 ? O TRP A 101 N ILE A 109 ? N ILE A 109 C 1 2 O ILE A 231 ? O ILE A 231 N GLU A 248 ? N GLU A 248 # _database_PDB_matrix.entry_id 1EV8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EV8 _atom_sites.fract_transf_matrix[1][1] 0.007338 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007338 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007338 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CXM 1 1 1 CXM CXM A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLN 17 17 17 GLN GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 CME 50 50 50 CME CBM A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 TRP 133 133 133 TRP TRP A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 MET 141 141 141 MET MET A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 CME 146 146 146 CME CBM A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 CYS 167 167 167 CYS CYS A . n A 1 168 CME 168 168 168 CME CBM A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 HIS 186 186 186 HIS HIS A . n A 1 187 MET 187 187 187 MET MET A . n A 1 188 MET 188 188 188 MET MET A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 GLN 190 190 190 GLN GLN A . n A 1 191 GLN 191 191 191 GLN GLN A . n A 1 192 CME 192 192 192 CME CBM A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 GLU 195 195 195 GLU GLU A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 PHE 199 199 199 PHE PHE A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 TRP 201 201 201 TRP TRP A . n A 1 202 THR 202 202 202 THR THR A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 TYR 209 209 209 TYR TYR A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 HIS 212 212 212 HIS HIS A . n A 1 213 MET 213 213 213 MET MET A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 GLN 215 215 215 GLN GLN A . n A 1 216 THR 216 216 216 THR THR A . n A 1 217 HIS 217 217 217 HIS HIS A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 GLN 219 219 219 GLN GLN A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 ARG 222 222 222 ARG ARG A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 PRO 228 228 228 PRO PRO A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 LYS 235 235 235 LYS LYS A . n A 1 236 PRO 236 236 236 PRO PRO A . n A 1 237 GLU 237 237 237 GLU ALA A . n A 1 238 SER 238 238 238 SER SER A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 ASP 241 241 241 ASP ASP A . n A 1 242 TYR 242 242 242 TYR TYR A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 PHE 244 244 244 PHE PHE A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 ASP 246 246 246 ASP ASP A . n A 1 247 PHE 247 247 247 PHE PHE A . n A 1 248 GLU 248 248 248 GLU GLU A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 TYR 252 252 252 TYR TYR A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 PRO 254 254 254 PRO PRO A . n A 1 255 HIS 255 255 255 HIS HIS A . n A 1 256 PRO 256 256 256 PRO PRO A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 LYS 259 259 259 LYS LYS A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 ILE 264 264 264 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 265 1 HOH HOH A . B 2 HOH 2 266 2 HOH HOH A . B 2 HOH 3 267 3 HOH HOH A . B 2 HOH 4 268 4 HOH HOH A . B 2 HOH 5 269 5 HOH HOH A . B 2 HOH 6 270 6 HOH HOH A . B 2 HOH 7 271 7 HOH HOH A . B 2 HOH 8 272 8 HOH HOH A . B 2 HOH 9 273 9 HOH HOH A . B 2 HOH 10 274 10 HOH HOH A . B 2 HOH 11 275 11 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CXM 1 A CXM 1 ? MET N-CARBOXYMETHIONINE 2 A CME 50 A CME 50 ? CYS 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' 3 A CME 146 A CME 146 ? CYS 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' 4 A CME 168 A CME 168 ? CYS 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' 5 A CME 192 A CME 192 ? CYS 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4270 ? 1 MORE -13 ? 1 'SSA (A^2)' 22640 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 16_556 x,-y,-z+3/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 204.4110000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-05-03 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-04 5 'Structure model' 1 4 2018-01-31 6 'Structure model' 1 5 2021-11-03 7 'Structure model' 1 6 2022-04-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Experimental preparation' 6 6 'Structure model' 'Database references' 7 6 'Structure model' 'Derived calculations' 8 7 'Structure model' 'Database references' 9 7 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' exptl_crystal_grow 3 6 'Structure model' database_2 4 6 'Structure model' struct_conn 5 6 'Structure model' struct_ref_seq_dif 6 7 'Structure model' audit_author 7 7 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_exptl_crystal_grow.pdbx_details' 2 5 'Structure model' '_exptl_crystal_grow.temp' 3 6 'Structure model' '_database_2.pdbx_DOI' 4 6 'Structure model' '_database_2.pdbx_database_accession' 5 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 6 'Structure model' '_struct_ref_seq_dif.details' 7 7 'Structure model' '_audit_author.identifier_ORCID' 8 7 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 CNS refinement 0.5 ? 2 SCALEPACK 'data scaling' . ? 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 20 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 N _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 22 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 18 ? ? 170.02 -166.38 2 1 ASP A 20 ? ? -114.13 -152.37 3 1 ARG A 21 ? ? -48.87 34.00 4 1 THR A 22 ? ? 69.55 78.24 5 1 PRO A 43 ? ? -77.85 47.66 6 1 VAL A 93 ? ? -75.35 -153.23 7 1 TYR A 94 ? ? -40.90 -78.23 8 1 ALA A 100 ? ? -162.08 55.49 9 1 ASP A 122 ? ? -152.45 59.06 10 1 ARG A 127 ? ? -149.78 41.63 11 1 ASN A 211 ? ? -86.95 31.76 12 1 PRO A 228 ? ? -77.34 -163.61 13 1 GLU A 245 ? ? -64.33 3.55 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 2 ? NZ ? A LYS 2 NZ 2 1 Y 1 A GLU 237 ? CG ? A GLU 237 CG 3 1 Y 1 A GLU 237 ? CD ? A GLU 237 CD 4 1 Y 1 A GLU 237 ? OE1 ? A GLU 237 OE1 5 1 Y 1 A GLU 237 ? OE2 ? A GLU 237 OE2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #