data_1F09 # _entry.id 1F09 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1F09 pdb_00001f09 10.2210/pdb1f09/pdb RCSB RCSB011085 ? ? WWPDB D_1000011085 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1YFP 'yellow variant of green fluorescent protein: YFP' unspecified PDB 2YFP 'yellow variant of green fluorescent protein: YFP-H148G' unspecified PDB 1F0B 'yellow variant of green fluorescent protein: YFP-H148Q' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F09 _pdbx_database_status.recvd_initial_deposition_date 2000-05-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wachter, R.M.' 1 'Yarbrough, D.' 2 'Kallio, K.' 3 'Remington, S.J.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystallographic and energetic analysis of binding of selected anions to the yellow variants of green fluorescent protein.' J.Mol.Biol. 301 157 171 2000 JMOBAK UK 0022-2836 0070 ? 10926499 10.1006/jmbi.2000.3905 1 'Sensitivity of the Yellow Variant of Green Fluorescent Protein to Halides and Nitrate' CURR.BIOL. 9 R628 R629 1999 CUBLE2 UK 0960-9822 2060 ? ? '10.1016/S0960-9822(99)80408-4' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wachter, R.M.' 1 ? primary 'Yarbrough, D.' 2 ? primary 'Kallio, K.' 3 ? primary 'Remington, S.J.' 4 ? 1 'Wachter, R.M.' 5 ? 1 'Remington, S.J.' 6 ? # _cell.entry_id 1F09 _cell.length_a 51.197 _cell.length_b 62.818 _cell.length_c 68.667 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1F09 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GREEN FLUORESCENT PROTEIN' 26951.408 1 ? 'S65G, V68L, S72A, Q80R, T203Y, H148Q' ? ? 2 non-polymer syn 'IODIDE ION' 126.904 2 ? ? ? ? 3 water nat water 18.015 105 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name GFP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTF(CR2)LQCFARYPDHM KRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSQNVYIMADKQK NGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKR HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSQNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LYS n 1 4 GLY n 1 5 GLU n 1 6 GLU n 1 7 LEU n 1 8 PHE n 1 9 THR n 1 10 GLY n 1 11 VAL n 1 12 VAL n 1 13 PRO n 1 14 ILE n 1 15 LEU n 1 16 VAL n 1 17 GLU n 1 18 LEU n 1 19 ASP n 1 20 GLY n 1 21 ASP n 1 22 VAL n 1 23 ASN n 1 24 GLY n 1 25 HIS n 1 26 LYS n 1 27 PHE n 1 28 SER n 1 29 VAL n 1 30 SER n 1 31 GLY n 1 32 GLU n 1 33 GLY n 1 34 GLU n 1 35 GLY n 1 36 ASP n 1 37 ALA n 1 38 THR n 1 39 TYR n 1 40 GLY n 1 41 LYS n 1 42 LEU n 1 43 THR n 1 44 LEU n 1 45 LYS n 1 46 PHE n 1 47 ILE n 1 48 CYS n 1 49 THR n 1 50 THR n 1 51 GLY n 1 52 LYS n 1 53 LEU n 1 54 PRO n 1 55 VAL n 1 56 PRO n 1 57 TRP n 1 58 PRO n 1 59 THR n 1 60 LEU n 1 61 VAL n 1 62 THR n 1 63 THR n 1 64 PHE n 1 65 CR2 n 1 66 LEU n 1 67 GLN n 1 68 CYS n 1 69 PHE n 1 70 ALA n 1 71 ARG n 1 72 TYR n 1 73 PRO n 1 74 ASP n 1 75 HIS n 1 76 MET n 1 77 LYS n 1 78 ARG n 1 79 HIS n 1 80 ASP n 1 81 PHE n 1 82 PHE n 1 83 LYS n 1 84 SER n 1 85 ALA n 1 86 MET n 1 87 PRO n 1 88 GLU n 1 89 GLY n 1 90 TYR n 1 91 VAL n 1 92 GLN n 1 93 GLU n 1 94 ARG n 1 95 THR n 1 96 ILE n 1 97 PHE n 1 98 PHE n 1 99 LYS n 1 100 ASP n 1 101 ASP n 1 102 GLY n 1 103 ASN n 1 104 TYR n 1 105 LYS n 1 106 THR n 1 107 ARG n 1 108 ALA n 1 109 GLU n 1 110 VAL n 1 111 LYS n 1 112 PHE n 1 113 GLU n 1 114 GLY n 1 115 ASP n 1 116 THR n 1 117 LEU n 1 118 VAL n 1 119 ASN n 1 120 ARG n 1 121 ILE n 1 122 GLU n 1 123 LEU n 1 124 LYS n 1 125 GLY n 1 126 ILE n 1 127 ASP n 1 128 PHE n 1 129 LYS n 1 130 GLU n 1 131 ASP n 1 132 GLY n 1 133 ASN n 1 134 ILE n 1 135 LEU n 1 136 GLY n 1 137 HIS n 1 138 LYS n 1 139 LEU n 1 140 GLU n 1 141 TYR n 1 142 ASN n 1 143 TYR n 1 144 ASN n 1 145 SER n 1 146 GLN n 1 147 ASN n 1 148 VAL n 1 149 TYR n 1 150 ILE n 1 151 MET n 1 152 ALA n 1 153 ASP n 1 154 LYS n 1 155 GLN n 1 156 LYS n 1 157 ASN n 1 158 GLY n 1 159 ILE n 1 160 LYS n 1 161 VAL n 1 162 ASN n 1 163 PHE n 1 164 LYS n 1 165 ILE n 1 166 ARG n 1 167 HIS n 1 168 ASN n 1 169 ILE n 1 170 GLU n 1 171 ASP n 1 172 GLY n 1 173 SER n 1 174 VAL n 1 175 GLN n 1 176 LEU n 1 177 ALA n 1 178 ASP n 1 179 HIS n 1 180 TYR n 1 181 GLN n 1 182 GLN n 1 183 ASN n 1 184 THR n 1 185 PRO n 1 186 ILE n 1 187 GLY n 1 188 ASP n 1 189 GLY n 1 190 PRO n 1 191 VAL n 1 192 LEU n 1 193 LEU n 1 194 PRO n 1 195 ASP n 1 196 ASN n 1 197 HIS n 1 198 TYR n 1 199 LEU n 1 200 SER n 1 201 TYR n 1 202 GLN n 1 203 SER n 1 204 ALA n 1 205 LEU n 1 206 SER n 1 207 LYS n 1 208 ASP n 1 209 PRO n 1 210 ASN n 1 211 GLU n 1 212 LYS n 1 213 ARG n 1 214 ASP n 1 215 HIS n 1 216 MET n 1 217 VAL n 1 218 LEU n 1 219 LEU n 1 220 GLU n 1 221 PHE n 1 222 VAL n 1 223 THR n 1 224 ALA n 1 225 ALA n 1 226 GLY n 1 227 ILE n 1 228 THR n 1 229 HIS n 1 230 GLY n 1 231 MET n 1 232 ASP n 1 233 GLU n 1 234 LEU n 1 235 TYR n 1 236 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Aequorea _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aequorea victoria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6100 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BL21DE3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code GFP_AEQVI _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P42212 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1F09 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 236 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42212 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1F09 CR2 A 65 ? UNP P42212 SER 65 chromophore 66 1 1 1F09 CR2 A 65 ? UNP P42212 TYR 66 chromophore 66 2 1 1F09 CR2 A 65 ? UNP P42212 GLY 67 chromophore 66 3 1 1F09 LEU A 66 ? UNP P42212 VAL 68 'engineered mutation' 68 4 1 1F09 ALA A 70 ? UNP P42212 SER 72 'engineered mutation' 72 5 1 1F09 ARG A 78 ? UNP P42212 GLN 80 'engineered mutation' 80 6 1 1F09 GLN A 146 ? UNP P42212 HIS 148 'engineered mutation' 148 7 1 1F09 TYR A 201 ? UNP P42212 THR 203 'engineered mutation' 203 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CR2 'L-peptide linking' n '{(4Z)-2-(aminomethyl)-4-[(4-hydroxyphenyl)methylidene]-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 'CHROMOPHORE (GLY-TYR-GLY)' 'C13 H13 N3 O4' 275.260 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IOD non-polymer . 'IODIDE ION' ? 'I -1' 126.904 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1F09 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 39.87 _exptl_crystal.density_Matthews 2.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.temp 277.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'PEG 1550, sodium acetate, magnesium chloride, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.0K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date 1999-08-30 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1F09 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.1 _reflns.d_resolution_high 2.10 _reflns.number_obs 10849 _reflns.number_all 35882 _reflns.percent_possible_obs 85.6 _reflns.pdbx_Rmerge_I_obs 0.09 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 6.7 _reflns.B_iso_Wilson_estimate 27.6 _reflns.pdbx_redundancy 3.31 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.18 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 79.6 _reflns_shell.Rmerge_I_obs 0.519 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 2.8 _reflns_shell.number_unique_all 990 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1F09 _refine.ls_number_reflns_obs 10831 _refine.ls_number_reflns_all 10831 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 30.1 _refine.ls_d_res_high 2.14 _refine.ls_percent_reflns_obs 85.6 _refine.ls_R_factor_obs 0.204 _refine.ls_R_factor_all 0.204 _refine.ls_R_factor_R_work 0.204 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1815 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 105 _refine_hist.number_atoms_total 1922 _refine_hist.d_res_high 2.14 _refine_hist.d_res_low 30.1 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.016 ? ? ? 'X-RAY DIFFRACTION' ? t_angle_deg 2.83 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1F09 _struct.title 'CRYSTAL STRUCTURE OF THE GREEN FLUORESCENT PROTEIN (GFP) VARIANT YFP-H148Q WITH TWO BOUND IODIDES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1F09 _struct_keywords.pdbx_keywords 'LUMINESCENT PROTEIN' _struct_keywords.text 'beta barrel, LUMINESCENCE, BIOLUMINESCENCE, PHOTOACTIVE PROTEIN, GREEN FLUORESCENT PROTEIN, Luminescent Protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 4 ? PHE A 8 ? GLY A 4 PHE A 8 5 ? 5 HELX_P HELX_P2 2 PRO A 56 ? VAL A 61 ? PRO A 56 VAL A 61 5 ? 6 HELX_P HELX_P3 3 LEU A 66 ? ALA A 70 ? LEU A 68 ALA A 72 5 ? 5 HELX_P HELX_P4 4 PRO A 73 ? HIS A 79 ? PRO A 75 HIS A 81 5 ? 7 HELX_P HELX_P5 5 ASP A 80 ? ALA A 85 ? ASP A 82 ALA A 87 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PHE 64 C ? ? ? 1_555 A CR2 65 N1 ? ? A PHE 64 A CR2 66 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? A CR2 65 C3 ? ? ? 1_555 A LEU 66 N ? ? A CR2 66 A LEU 68 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 86 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 88 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 87 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 89 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.25 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel A 10 11 ? anti-parallel A 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 11 ? VAL A 22 ? VAL A 11 VAL A 22 A 2 HIS A 25 ? ASP A 36 ? HIS A 25 ASP A 36 A 3 LYS A 41 ? CYS A 48 ? LYS A 41 CYS A 48 A 4 HIS A 215 ? ALA A 225 ? HIS A 217 ALA A 227 A 5 HIS A 197 ? SER A 206 ? HIS A 199 SER A 208 A 6 GLN A 146 ? ASP A 153 ? GLN A 148 ASP A 155 A 7 GLY A 158 ? ASN A 168 ? GLY A 160 ASN A 170 A 8 VAL A 174 ? PRO A 185 ? VAL A 176 PRO A 187 A 9 TYR A 90 ? PHE A 98 ? TYR A 92 PHE A 100 A 10 ASN A 103 ? GLU A 113 ? ASN A 105 GLU A 115 A 11 THR A 116 ? ILE A 126 ? THR A 118 ILE A 128 A 12 VAL A 11 ? VAL A 22 ? VAL A 11 VAL A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 22 ? O VAL A 22 N HIS A 25 ? N HIS A 25 A 2 3 N ASP A 36 ? N ASP A 36 O LYS A 41 ? O LYS A 41 A 3 4 N PHE A 46 ? N PHE A 46 O MET A 216 ? O MET A 218 A 4 5 N ALA A 225 ? N ALA A 227 O TYR A 198 ? O TYR A 200 A 5 6 N TYR A 201 ? N TYR A 203 O GLN A 146 ? O GLN A 148 A 6 7 O ASP A 153 ? O ASP A 155 N GLY A 158 ? N GLY A 160 A 7 8 O HIS A 167 ? O HIS A 169 N GLN A 175 ? N GLN A 177 A 8 9 O THR A 184 ? O THR A 186 N VAL A 91 ? N VAL A 93 A 9 10 N ILE A 96 ? N ILE A 98 O TYR A 104 ? O TYR A 106 A 10 11 N GLU A 113 ? N GLU A 115 O THR A 116 ? O THR A 118 A 11 12 N LEU A 117 ? N LEU A 119 O PRO A 13 ? O PRO A 13 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id IOD _struct_site.pdbx_auth_seq_id 254 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE IOD A 254' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 GLN A 67 ? GLN A 69 . ? 1_555 ? 2 AC1 2 TYR A 201 ? TYR A 203 . ? 1_555 ? # _database_PDB_matrix.entry_id 1F09 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1F09 _atom_sites.fract_transf_matrix[1][1] 0.019532 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015919 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014563 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C I N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 CR2 65 66 66 CR2 CRO A . n A 1 66 LEU 66 68 68 LEU LEU A . n A 1 67 GLN 67 69 69 GLN GLN A . n A 1 68 CYS 68 70 70 CYS CYS A . n A 1 69 PHE 69 71 71 PHE PHE A . n A 1 70 ALA 70 72 72 ALA ALA A . n A 1 71 ARG 71 73 73 ARG ARG A . n A 1 72 TYR 72 74 74 TYR TYR A . n A 1 73 PRO 73 75 75 PRO PRO A . n A 1 74 ASP 74 76 76 ASP ASP A . n A 1 75 HIS 75 77 77 HIS HIS A . n A 1 76 MET 76 78 78 MET MET A . n A 1 77 LYS 77 79 79 LYS LYS A . n A 1 78 ARG 78 80 80 ARG ARG A . n A 1 79 HIS 79 81 81 HIS HIS A . n A 1 80 ASP 80 82 82 ASP ASP A . n A 1 81 PHE 81 83 83 PHE PHE A . n A 1 82 PHE 82 84 84 PHE PHE A . n A 1 83 LYS 83 85 85 LYS LYS A . n A 1 84 SER 84 86 86 SER SER A . n A 1 85 ALA 85 87 87 ALA ALA A . n A 1 86 MET 86 88 88 MET MET A . n A 1 87 PRO 87 89 89 PRO PRO A . n A 1 88 GLU 88 90 90 GLU GLU A . n A 1 89 GLY 89 91 91 GLY GLY A . n A 1 90 TYR 90 92 92 TYR TYR A . n A 1 91 VAL 91 93 93 VAL VAL A . n A 1 92 GLN 92 94 94 GLN GLN A . n A 1 93 GLU 93 95 95 GLU GLU A . n A 1 94 ARG 94 96 96 ARG ARG A . n A 1 95 THR 95 97 97 THR THR A . n A 1 96 ILE 96 98 98 ILE ILE A . n A 1 97 PHE 97 99 99 PHE PHE A . n A 1 98 PHE 98 100 100 PHE PHE A . n A 1 99 LYS 99 101 101 LYS LYS A . n A 1 100 ASP 100 102 102 ASP ASP A . n A 1 101 ASP 101 103 103 ASP ASP A . n A 1 102 GLY 102 104 104 GLY GLY A . n A 1 103 ASN 103 105 105 ASN ASN A . n A 1 104 TYR 104 106 106 TYR TYR A . n A 1 105 LYS 105 107 107 LYS LYS A . n A 1 106 THR 106 108 108 THR THR A . n A 1 107 ARG 107 109 109 ARG ARG A . n A 1 108 ALA 108 110 110 ALA ALA A . n A 1 109 GLU 109 111 111 GLU GLU A . n A 1 110 VAL 110 112 112 VAL VAL A . n A 1 111 LYS 111 113 113 LYS LYS A . n A 1 112 PHE 112 114 114 PHE PHE A . n A 1 113 GLU 113 115 115 GLU GLU A . n A 1 114 GLY 114 116 116 GLY GLY A . n A 1 115 ASP 115 117 117 ASP ASP A . n A 1 116 THR 116 118 118 THR THR A . n A 1 117 LEU 117 119 119 LEU LEU A . n A 1 118 VAL 118 120 120 VAL VAL A . n A 1 119 ASN 119 121 121 ASN ASN A . n A 1 120 ARG 120 122 122 ARG ARG A . n A 1 121 ILE 121 123 123 ILE ILE A . n A 1 122 GLU 122 124 124 GLU GLU A . n A 1 123 LEU 123 125 125 LEU LEU A . n A 1 124 LYS 124 126 126 LYS LYS A . n A 1 125 GLY 125 127 127 GLY GLY A . n A 1 126 ILE 126 128 128 ILE ILE A . n A 1 127 ASP 127 129 129 ASP ASP A . n A 1 128 PHE 128 130 130 PHE PHE A . n A 1 129 LYS 129 131 131 LYS LYS A . n A 1 130 GLU 130 132 132 GLU GLU A . n A 1 131 ASP 131 133 133 ASP ASP A . n A 1 132 GLY 132 134 134 GLY GLY A . n A 1 133 ASN 133 135 135 ASN ASN A . n A 1 134 ILE 134 136 136 ILE ILE A . n A 1 135 LEU 135 137 137 LEU LEU A . n A 1 136 GLY 136 138 138 GLY GLY A . n A 1 137 HIS 137 139 139 HIS HIS A . n A 1 138 LYS 138 140 140 LYS LYS A . n A 1 139 LEU 139 141 141 LEU LEU A . n A 1 140 GLU 140 142 142 GLU GLU A . n A 1 141 TYR 141 143 143 TYR TYR A . n A 1 142 ASN 142 144 144 ASN ASN A . n A 1 143 TYR 143 145 145 TYR TYR A . n A 1 144 ASN 144 146 146 ASN ASN A . n A 1 145 SER 145 147 147 SER SER A . n A 1 146 GLN 146 148 148 GLN GLN A . n A 1 147 ASN 147 149 149 ASN ASN A . n A 1 148 VAL 148 150 150 VAL VAL A . n A 1 149 TYR 149 151 151 TYR TYR A . n A 1 150 ILE 150 152 152 ILE ILE A . n A 1 151 MET 151 153 153 MET MET A . n A 1 152 ALA 152 154 154 ALA ALA A . n A 1 153 ASP 153 155 155 ASP ASP A . n A 1 154 LYS 154 156 156 LYS LYS A . n A 1 155 GLN 155 157 157 GLN GLN A . n A 1 156 LYS 156 158 158 LYS LYS A . n A 1 157 ASN 157 159 159 ASN ASN A . n A 1 158 GLY 158 160 160 GLY GLY A . n A 1 159 ILE 159 161 161 ILE ILE A . n A 1 160 LYS 160 162 162 LYS LYS A . n A 1 161 VAL 161 163 163 VAL VAL A . n A 1 162 ASN 162 164 164 ASN ASN A . n A 1 163 PHE 163 165 165 PHE PHE A . n A 1 164 LYS 164 166 166 LYS LYS A . n A 1 165 ILE 165 167 167 ILE ILE A . n A 1 166 ARG 166 168 168 ARG ARG A . n A 1 167 HIS 167 169 169 HIS HIS A . n A 1 168 ASN 168 170 170 ASN ASN A . n A 1 169 ILE 169 171 171 ILE ILE A . n A 1 170 GLU 170 172 172 GLU GLU A . n A 1 171 ASP 171 173 173 ASP ASP A . n A 1 172 GLY 172 174 174 GLY GLY A . n A 1 173 SER 173 175 175 SER SER A . n A 1 174 VAL 174 176 176 VAL VAL A . n A 1 175 GLN 175 177 177 GLN GLN A . n A 1 176 LEU 176 178 178 LEU LEU A . n A 1 177 ALA 177 179 179 ALA ALA A . n A 1 178 ASP 178 180 180 ASP ASP A . n A 1 179 HIS 179 181 181 HIS HIS A . n A 1 180 TYR 180 182 182 TYR TYR A . n A 1 181 GLN 181 183 183 GLN GLN A . n A 1 182 GLN 182 184 184 GLN GLN A . n A 1 183 ASN 183 185 185 ASN ASN A . n A 1 184 THR 184 186 186 THR THR A . n A 1 185 PRO 185 187 187 PRO PRO A . n A 1 186 ILE 186 188 188 ILE ILE A . n A 1 187 GLY 187 189 189 GLY GLY A . n A 1 188 ASP 188 190 190 ASP ASP A . n A 1 189 GLY 189 191 191 GLY GLY A . n A 1 190 PRO 190 192 192 PRO PRO A . n A 1 191 VAL 191 193 193 VAL VAL A . n A 1 192 LEU 192 194 194 LEU LEU A . n A 1 193 LEU 193 195 195 LEU LEU A . n A 1 194 PRO 194 196 196 PRO PRO A . n A 1 195 ASP 195 197 197 ASP ASP A . n A 1 196 ASN 196 198 198 ASN ASN A . n A 1 197 HIS 197 199 199 HIS HIS A . n A 1 198 TYR 198 200 200 TYR TYR A . n A 1 199 LEU 199 201 201 LEU LEU A . n A 1 200 SER 200 202 202 SER SER A . n A 1 201 TYR 201 203 203 TYR TYR A . n A 1 202 GLN 202 204 204 GLN GLN A . n A 1 203 SER 203 205 205 SER SER A . n A 1 204 ALA 204 206 206 ALA ALA A . n A 1 205 LEU 205 207 207 LEU LEU A . n A 1 206 SER 206 208 208 SER SER A . n A 1 207 LYS 207 209 209 LYS LYS A . n A 1 208 ASP 208 210 210 ASP ASP A . n A 1 209 PRO 209 211 211 PRO PRO A . n A 1 210 ASN 210 212 212 ASN ASN A . n A 1 211 GLU 211 213 213 GLU GLU A . n A 1 212 LYS 212 214 214 LYS LYS A . n A 1 213 ARG 213 215 215 ARG ARG A . n A 1 214 ASP 214 216 216 ASP ASP A . n A 1 215 HIS 215 217 217 HIS HIS A . n A 1 216 MET 216 218 218 MET MET A . n A 1 217 VAL 217 219 219 VAL VAL A . n A 1 218 LEU 218 220 220 LEU LEU A . n A 1 219 LEU 219 221 221 LEU LEU A . n A 1 220 GLU 220 222 222 GLU GLU A . n A 1 221 PHE 221 223 223 PHE PHE A . n A 1 222 VAL 222 224 224 VAL VAL A . n A 1 223 THR 223 225 225 THR THR A . n A 1 224 ALA 224 226 226 ALA ALA A . n A 1 225 ALA 225 227 227 ALA ALA A . n A 1 226 GLY 226 228 228 GLY GLY A . n A 1 227 ILE 227 229 229 ILE ILE A . n A 1 228 THR 228 230 ? ? ? A . n A 1 229 HIS 229 231 ? ? ? A . n A 1 230 GLY 230 232 ? ? ? A . n A 1 231 MET 231 233 ? ? ? A . n A 1 232 ASP 232 234 ? ? ? A . n A 1 233 GLU 233 235 ? ? ? A . n A 1 234 LEU 234 236 ? ? ? A . n A 1 235 TYR 235 237 ? ? ? A . n A 1 236 LYS 236 238 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IOD 1 251 251 IOD I- A . C 2 IOD 1 254 254 IOD I- A . D 3 HOH 1 252 252 HOH HOH A . D 3 HOH 2 253 253 HOH HOH A . D 3 HOH 3 255 255 HOH HOH A . D 3 HOH 4 256 256 HOH HOH A . D 3 HOH 5 257 257 HOH HOH A . D 3 HOH 6 258 258 HOH HOH A . D 3 HOH 7 259 259 HOH HOH A . D 3 HOH 8 260 260 HOH HOH A . D 3 HOH 9 261 261 HOH HOH A . D 3 HOH 10 262 262 HOH HOH A . D 3 HOH 11 264 264 HOH HOH A . D 3 HOH 12 265 265 HOH HOH A . D 3 HOH 13 266 266 HOH HOH A . D 3 HOH 14 268 268 HOH HOH A . D 3 HOH 15 269 269 HOH HOH A . D 3 HOH 16 270 270 HOH HOH A . D 3 HOH 17 271 271 HOH HOH A . D 3 HOH 18 273 273 HOH HOH A . D 3 HOH 19 274 274 HOH HOH A . D 3 HOH 20 275 275 HOH HOH A . D 3 HOH 21 278 278 HOH HOH A . D 3 HOH 22 280 280 HOH HOH A . D 3 HOH 23 281 281 HOH HOH A . D 3 HOH 24 283 283 HOH HOH A . D 3 HOH 25 284 284 HOH HOH A . D 3 HOH 26 285 285 HOH HOH A . D 3 HOH 27 287 287 HOH HOH A . D 3 HOH 28 290 290 HOH HOH A . D 3 HOH 29 291 291 HOH HOH A . D 3 HOH 30 292 292 HOH HOH A . D 3 HOH 31 293 293 HOH HOH A . D 3 HOH 32 294 294 HOH HOH A . D 3 HOH 33 296 296 HOH HOH A . D 3 HOH 34 298 298 HOH HOH A . D 3 HOH 35 300 300 HOH HOH A . D 3 HOH 36 301 301 HOH HOH A . D 3 HOH 37 303 303 HOH HOH A . D 3 HOH 38 304 304 HOH HOH A . D 3 HOH 39 305 305 HOH HOH A . D 3 HOH 40 306 306 HOH HOH A . D 3 HOH 41 307 307 HOH HOH A . D 3 HOH 42 308 308 HOH HOH A . D 3 HOH 43 312 312 HOH HOH A . D 3 HOH 44 314 314 HOH HOH A . D 3 HOH 45 315 315 HOH HOH A . D 3 HOH 46 317 317 HOH HOH A . D 3 HOH 47 318 318 HOH HOH A . D 3 HOH 48 319 319 HOH HOH A . D 3 HOH 49 320 320 HOH HOH A . D 3 HOH 50 321 321 HOH HOH A . D 3 HOH 51 322 322 HOH HOH A . D 3 HOH 52 323 323 HOH HOH A . D 3 HOH 53 325 325 HOH HOH A . D 3 HOH 54 327 327 HOH HOH A . D 3 HOH 55 328 328 HOH HOH A . D 3 HOH 56 330 330 HOH HOH A . D 3 HOH 57 331 331 HOH HOH A . D 3 HOH 58 332 332 HOH HOH A . D 3 HOH 59 333 333 HOH HOH A . D 3 HOH 60 334 334 HOH HOH A . D 3 HOH 61 335 335 HOH HOH A . D 3 HOH 62 336 336 HOH HOH A . D 3 HOH 63 337 337 HOH HOH A . D 3 HOH 64 338 338 HOH HOH A . D 3 HOH 65 339 339 HOH HOH A . D 3 HOH 66 341 341 HOH HOH A . D 3 HOH 67 344 344 HOH HOH A . D 3 HOH 68 345 345 HOH HOH A . D 3 HOH 69 346 346 HOH HOH A . D 3 HOH 70 348 348 HOH HOH A . D 3 HOH 71 349 349 HOH HOH A . D 3 HOH 72 350 350 HOH HOH A . D 3 HOH 73 351 351 HOH HOH A . D 3 HOH 74 352 352 HOH HOH A . D 3 HOH 75 353 353 HOH HOH A . D 3 HOH 76 354 354 HOH HOH A . D 3 HOH 77 355 355 HOH HOH A . D 3 HOH 78 357 357 HOH HOH A . D 3 HOH 79 361 361 HOH HOH A . D 3 HOH 80 362 362 HOH HOH A . D 3 HOH 81 363 363 HOH HOH A . D 3 HOH 82 365 365 HOH HOH A . D 3 HOH 83 367 367 HOH HOH A . D 3 HOH 84 368 368 HOH HOH A . D 3 HOH 85 370 370 HOH HOH A . D 3 HOH 86 371 371 HOH HOH A . D 3 HOH 87 372 372 HOH HOH A . D 3 HOH 88 373 373 HOH HOH A . D 3 HOH 89 374 374 HOH HOH A . D 3 HOH 90 375 375 HOH HOH A . D 3 HOH 91 377 377 HOH HOH A . D 3 HOH 92 378 378 HOH HOH A . D 3 HOH 93 380 380 HOH HOH A . D 3 HOH 94 383 383 HOH HOH A . D 3 HOH 95 384 384 HOH HOH A . D 3 HOH 96 387 387 HOH HOH A . D 3 HOH 97 388 388 HOH HOH A . D 3 HOH 98 389 389 HOH HOH A . D 3 HOH 99 391 391 HOH HOH A . D 3 HOH 100 392 392 HOH HOH A . D 3 HOH 101 393 393 HOH HOH A . D 3 HOH 102 394 394 HOH HOH A . D 3 HOH 103 396 396 HOH HOH A . D 3 HOH 104 397 397 HOH HOH A . D 3 HOH 105 398 398 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CR2 65 A CR2 66 ? GLY ? 2 A CR2 65 A CR2 66 ? TYR ? 3 A CR2 65 A CR2 66 ? GLY ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-11-17 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_conn 3 4 'Structure model' struct_ref_seq_dif 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 9 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 14 4 'Structure model' '_struct_ref_seq_dif.details' 15 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal TNT refinement . ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 TNT phasing . ? 4 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.327 1.252 0.075 0.011 N 2 1 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.326 1.252 0.074 0.011 N 3 1 CD A GLU 90 ? ? OE2 A GLU 90 ? ? 1.323 1.252 0.071 0.011 N 4 1 CD A GLU 95 ? ? OE2 A GLU 95 ? ? 1.321 1.252 0.069 0.011 N 5 1 CD A GLU 115 ? ? OE2 A GLU 115 ? ? 1.324 1.252 0.072 0.011 N 6 1 CD A GLU 222 ? ? OE2 A GLU 222 ? ? 1.324 1.252 0.072 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A LEU 15 ? ? CA A LEU 15 ? ? CB A LEU 15 ? ? 97.10 110.40 -13.30 2.00 N 2 1 CB A ASP 19 ? ? CG A ASP 19 ? ? OD2 A ASP 19 ? ? 111.50 118.30 -6.80 0.90 N 3 1 CB A ASP 21 ? ? CG A ASP 21 ? ? OD1 A ASP 21 ? ? 124.35 118.30 6.05 0.90 N 4 1 CB A ASP 21 ? ? CG A ASP 21 ? ? OD2 A ASP 21 ? ? 112.50 118.30 -5.80 0.90 N 5 1 CB A ASP 76 ? ? CG A ASP 76 ? ? OD2 A ASP 76 ? ? 110.97 118.30 -7.33 0.90 N 6 1 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.57 120.30 4.27 0.50 N 7 1 CB A ASP 82 ? ? CG A ASP 82 ? ? OD1 A ASP 82 ? ? 127.11 118.30 8.81 0.90 N 8 1 CB A ASP 82 ? ? CG A ASP 82 ? ? OD2 A ASP 82 ? ? 108.24 118.30 -10.06 0.90 N 9 1 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH1 A ARG 96 ? ? 123.94 120.30 3.64 0.50 N 10 1 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH2 A ARG 96 ? ? 115.43 120.30 -4.87 0.50 N 11 1 CB A ASP 102 ? ? CG A ASP 102 ? ? OD2 A ASP 102 ? ? 112.34 118.30 -5.96 0.90 N 12 1 CB A ASP 103 ? ? CG A ASP 103 ? ? OD2 A ASP 103 ? ? 112.04 118.30 -6.26 0.90 N 13 1 CB A TYR 106 ? ? CG A TYR 106 ? ? CD2 A TYR 106 ? ? 117.40 121.00 -3.60 0.60 N 14 1 CB A TYR 106 ? ? CG A TYR 106 ? ? CD1 A TYR 106 ? ? 125.63 121.00 4.63 0.60 N 15 1 NE A ARG 109 ? ? CZ A ARG 109 ? ? NH1 A ARG 109 ? ? 123.86 120.30 3.56 0.50 N 16 1 CB A ASP 155 ? ? CG A ASP 155 ? ? OD2 A ASP 155 ? ? 112.46 118.30 -5.84 0.90 N 17 1 CB A ASP 180 ? ? CG A ASP 180 ? ? OD2 A ASP 180 ? ? 111.60 118.30 -6.70 0.90 N 18 1 CB A ASP 190 ? ? CG A ASP 190 ? ? OD2 A ASP 190 ? ? 112.73 118.30 -5.57 0.90 N 19 1 CB A ASP 197 ? ? CA A ASP 197 ? ? C A ASP 197 ? ? 122.71 110.40 12.31 2.00 N 20 1 CB A TYR 200 ? ? CA A TYR 200 ? ? C A TYR 200 ? ? 95.00 110.40 -15.40 2.00 N 21 1 CA A TYR 200 ? ? CB A TYR 200 ? ? CG A TYR 200 ? ? 126.55 113.40 13.15 1.90 N 22 1 CB A ASP 210 ? ? CG A ASP 210 ? ? OD1 A ASP 210 ? ? 124.14 118.30 5.84 0.90 N 23 1 C A ASP 210 ? ? N A PRO 211 ? ? CD A PRO 211 ? ? 113.67 128.40 -14.73 2.10 Y 24 1 NE A ARG 215 ? ? CZ A ARG 215 ? ? NH1 A ARG 215 ? ? 123.54 120.30 3.24 0.50 N 25 1 CB A ASP 216 ? ? CG A ASP 216 ? ? OD1 A ASP 216 ? ? 124.22 118.30 5.92 0.90 N 26 1 CB A ASP 216 ? ? CG A ASP 216 ? ? OD2 A ASP 216 ? ? 111.49 118.30 -6.81 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 9 ? ? -30.83 -33.80 2 1 ILE A 136 ? ? -83.20 -73.45 3 1 GLN A 148 ? ? -174.91 149.81 4 1 HIS A 199 ? ? -156.84 -153.12 5 1 PRO A 211 ? ? -38.73 -36.47 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LYS 3 ? CB ? A LYS 3 CB 2 1 Y 0 A LYS 3 ? CG ? A LYS 3 CG 3 1 Y 0 A LYS 3 ? CD ? A LYS 3 CD 4 1 Y 0 A LYS 3 ? CE ? A LYS 3 CE 5 1 Y 0 A LYS 3 ? NZ ? A LYS 3 NZ 6 1 Y 0 A GLU 6 ? CD ? A GLU 6 CD 7 1 Y 0 A GLU 6 ? OE1 ? A GLU 6 OE1 8 1 Y 0 A GLU 6 ? OE2 ? A GLU 6 OE2 9 1 Y 0 A GLU 132 ? CD ? A GLU 130 CD 10 1 Y 0 A GLU 132 ? OE1 ? A GLU 130 OE1 11 1 Y 0 A GLU 132 ? OE2 ? A GLU 130 OE2 12 1 Y 0 A ASP 133 ? CB ? A ASP 131 CB 13 1 Y 0 A ASP 133 ? CG ? A ASP 131 CG 14 1 Y 0 A ASP 133 ? OD1 ? A ASP 131 OD1 15 1 Y 0 A ASP 133 ? OD2 ? A ASP 131 OD2 16 1 Y 0 A LYS 156 ? CG ? A LYS 154 CG 17 1 Y 0 A LYS 156 ? CD ? A LYS 154 CD 18 1 Y 0 A LYS 156 ? CE ? A LYS 154 CE 19 1 Y 0 A LYS 156 ? NZ ? A LYS 154 NZ 20 1 Y 0 A GLN 157 ? CG ? A GLN 155 CG 21 1 Y 0 A GLN 157 ? CD ? A GLN 155 CD 22 1 Y 0 A GLN 157 ? OE1 ? A GLN 155 OE1 23 1 Y 0 A GLN 157 ? NE2 ? A GLN 155 NE2 24 1 Y 0 A LYS 158 ? CE ? A LYS 156 CE 25 1 Y 0 A LYS 158 ? NZ ? A LYS 156 NZ 26 1 Y 0 A ASN 164 ? OD1 ? A ASN 162 OD1 27 1 Y 0 A ASN 164 ? ND2 ? A ASN 162 ND2 28 1 Y 0 A ARG 168 ? NE ? A ARG 166 NE 29 1 Y 0 A ARG 168 ? CZ ? A ARG 166 CZ 30 1 Y 0 A ARG 168 ? NH1 ? A ARG 166 NH1 31 1 Y 0 A ARG 168 ? NH2 ? A ARG 166 NH2 32 1 Y 0 A GLN 184 ? CD ? A GLN 182 CD 33 1 Y 0 A GLN 184 ? OE1 ? A GLN 182 OE1 34 1 Y 0 A GLN 184 ? NE2 ? A GLN 182 NE2 35 1 Y 0 A ASP 190 ? CG ? A ASP 188 CG 36 1 Y 0 A ASP 190 ? OD1 ? A ASP 188 OD1 37 1 Y 0 A ASP 190 ? OD2 ? A ASP 188 OD2 38 1 Y 0 A ASN 212 ? CG ? A ASN 210 CG 39 1 Y 0 A ASN 212 ? OD1 ? A ASN 210 OD1 40 1 Y 0 A ASN 212 ? ND2 ? A ASN 210 ND2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 230 ? A THR 228 3 1 Y 1 A HIS 231 ? A HIS 229 4 1 Y 1 A GLY 232 ? A GLY 230 5 1 Y 1 A MET 233 ? A MET 231 6 1 Y 1 A ASP 234 ? A ASP 232 7 1 Y 1 A GLU 235 ? A GLU 233 8 1 Y 1 A LEU 236 ? A LEU 234 9 1 Y 1 A TYR 237 ? A TYR 235 10 1 Y 1 A LYS 238 ? A LYS 236 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IODIDE ION' IOD 3 water HOH #