data_1F3O # _entry.id 1F3O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1F3O RCSB RCSB011203 WWPDB D_1000011203 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F3O _pdbx_database_status.recvd_initial_deposition_date 2000-06-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yuan, Y.-R.' 1 'Hunt, J.F.' 2 # _citation.id primary _citation.title ;The crystal structure of the MJ0796 ATP-binding cassette. Implications for the structural consequences of ATP hydrolysis in the active site of an ABC transporter. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 276 _citation.page_first 32313 _citation.page_last 32321 _citation.year 2001 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11402022 _citation.pdbx_database_id_DOI 10.1074/jbc.M100758200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yuan, Y.R.' 1 primary 'Blecker, S.' 2 primary 'Martsinkevich, O.' 3 primary 'Millen, L.' 4 primary 'Thomas, P.J.' 5 primary 'Hunt, J.F.' 6 # _cell.entry_id 1F3O _cell.length_a 55.210 _cell.length_b 65.200 _cell.length_c 126.880 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1F3O _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN MJ0796' 26931.941 1 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201 1 ? ? ? ? 4 water nat water 18.015 64 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)IKLKNVTKTYK(MSE)GEEIIYALKNVNLNIKEGEFVSI(MSE)GPSGSGKST(MSE)LNIIGCLDKPTEGEVYI DNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGA(MSE)SGEERRKRALECLK(MSE)AELEE RFANHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKI(MSE)QLLKKLNEEDGKTVVVVTHDINVARFG ERIIYLKDGEVEREEKLRGFDDR ; _entity_poly.pdbx_seq_one_letter_code_can ;MIKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKI RRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARAL ANNPPIILADEPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKDGEVEREEKLRGFDDR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ILE n 1 3 LYS n 1 4 LEU n 1 5 LYS n 1 6 ASN n 1 7 VAL n 1 8 THR n 1 9 LYS n 1 10 THR n 1 11 TYR n 1 12 LYS n 1 13 MSE n 1 14 GLY n 1 15 GLU n 1 16 GLU n 1 17 ILE n 1 18 ILE n 1 19 TYR n 1 20 ALA n 1 21 LEU n 1 22 LYS n 1 23 ASN n 1 24 VAL n 1 25 ASN n 1 26 LEU n 1 27 ASN n 1 28 ILE n 1 29 LYS n 1 30 GLU n 1 31 GLY n 1 32 GLU n 1 33 PHE n 1 34 VAL n 1 35 SER n 1 36 ILE n 1 37 MSE n 1 38 GLY n 1 39 PRO n 1 40 SER n 1 41 GLY n 1 42 SER n 1 43 GLY n 1 44 LYS n 1 45 SER n 1 46 THR n 1 47 MSE n 1 48 LEU n 1 49 ASN n 1 50 ILE n 1 51 ILE n 1 52 GLY n 1 53 CYS n 1 54 LEU n 1 55 ASP n 1 56 LYS n 1 57 PRO n 1 58 THR n 1 59 GLU n 1 60 GLY n 1 61 GLU n 1 62 VAL n 1 63 TYR n 1 64 ILE n 1 65 ASP n 1 66 ASN n 1 67 ILE n 1 68 LYS n 1 69 THR n 1 70 ASN n 1 71 ASP n 1 72 LEU n 1 73 ASP n 1 74 ASP n 1 75 ASP n 1 76 GLU n 1 77 LEU n 1 78 THR n 1 79 LYS n 1 80 ILE n 1 81 ARG n 1 82 ARG n 1 83 ASP n 1 84 LYS n 1 85 ILE n 1 86 GLY n 1 87 PHE n 1 88 VAL n 1 89 PHE n 1 90 GLN n 1 91 GLN n 1 92 PHE n 1 93 ASN n 1 94 LEU n 1 95 ILE n 1 96 PRO n 1 97 LEU n 1 98 LEU n 1 99 THR n 1 100 ALA n 1 101 LEU n 1 102 GLU n 1 103 ASN n 1 104 VAL n 1 105 GLU n 1 106 LEU n 1 107 PRO n 1 108 LEU n 1 109 ILE n 1 110 PHE n 1 111 LYS n 1 112 TYR n 1 113 ARG n 1 114 GLY n 1 115 ALA n 1 116 MSE n 1 117 SER n 1 118 GLY n 1 119 GLU n 1 120 GLU n 1 121 ARG n 1 122 ARG n 1 123 LYS n 1 124 ARG n 1 125 ALA n 1 126 LEU n 1 127 GLU n 1 128 CYS n 1 129 LEU n 1 130 LYS n 1 131 MSE n 1 132 ALA n 1 133 GLU n 1 134 LEU n 1 135 GLU n 1 136 GLU n 1 137 ARG n 1 138 PHE n 1 139 ALA n 1 140 ASN n 1 141 HIS n 1 142 LYS n 1 143 PRO n 1 144 ASN n 1 145 GLN n 1 146 LEU n 1 147 SER n 1 148 GLY n 1 149 GLY n 1 150 GLN n 1 151 GLN n 1 152 GLN n 1 153 ARG n 1 154 VAL n 1 155 ALA n 1 156 ILE n 1 157 ALA n 1 158 ARG n 1 159 ALA n 1 160 LEU n 1 161 ALA n 1 162 ASN n 1 163 ASN n 1 164 PRO n 1 165 PRO n 1 166 ILE n 1 167 ILE n 1 168 LEU n 1 169 ALA n 1 170 ASP n 1 171 GLU n 1 172 PRO n 1 173 THR n 1 174 GLY n 1 175 ALA n 1 176 LEU n 1 177 ASP n 1 178 SER n 1 179 LYS n 1 180 THR n 1 181 GLY n 1 182 GLU n 1 183 LYS n 1 184 ILE n 1 185 MSE n 1 186 GLN n 1 187 LEU n 1 188 LEU n 1 189 LYS n 1 190 LYS n 1 191 LEU n 1 192 ASN n 1 193 GLU n 1 194 GLU n 1 195 ASP n 1 196 GLY n 1 197 LYS n 1 198 THR n 1 199 VAL n 1 200 VAL n 1 201 VAL n 1 202 VAL n 1 203 THR n 1 204 HIS n 1 205 ASP n 1 206 ILE n 1 207 ASN n 1 208 VAL n 1 209 ALA n 1 210 ARG n 1 211 PHE n 1 212 GLY n 1 213 GLU n 1 214 ARG n 1 215 ILE n 1 216 ILE n 1 217 TYR n 1 218 LEU n 1 219 LYS n 1 220 ASP n 1 221 GLY n 1 222 GLU n 1 223 VAL n 1 224 GLU n 1 225 ARG n 1 226 GLU n 1 227 GLU n 1 228 LYS n 1 229 LEU n 1 230 ARG n 1 231 GLY n 1 232 PHE n 1 233 ASP n 1 234 ASP n 1 235 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Methanocaldococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanocaldococcus jannaschii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2190 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene 'GENOMIC DNA' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code Y796_METJA _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q58206 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MIKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKI RRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARAL ANNPPIILADEPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKDGEVEREEKLRGFDDR ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1F3O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 235 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q58206 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 235 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 235 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1F3O MSE A 1 ? UNP Q58206 MET 1 'MODIFIED RESIDUE' 1 1 1 1F3O MSE A 13 ? UNP Q58206 MET 13 'MODIFIED RESIDUE' 13 2 1 1F3O MSE A 37 ? UNP Q58206 MET 37 'MODIFIED RESIDUE' 37 3 1 1F3O MSE A 47 ? UNP Q58206 MET 47 'MODIFIED RESIDUE' 47 4 1 1F3O MSE A 116 ? UNP Q58206 MET 116 'MODIFIED RESIDUE' 116 5 1 1F3O MSE A 131 ? UNP Q58206 MET 131 'MODIFIED RESIDUE' 131 6 1 1F3O MSE A 185 ? UNP Q58206 MET 185 'MODIFIED RESIDUE' 185 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADP non-polymer n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1F3O _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 41.98 _exptl_crystal.density_Matthews 2.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.temp 294.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'PEG 4000, Ammonium Acetate, Glycerol, ADP, Magnesium Chloride, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 21K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 130 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type BRANDEIS _diffrn_detector.pdbx_collection_date 2000-04-20 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.932 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X12C' _diffrn_source.pdbx_wavelength 0.932 _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X12C _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1F3O _reflns.observed_criterion_sigma_I 3.0 _reflns.observed_criterion_sigma_F 1.0 _reflns.d_resolution_low 30 _reflns.d_resolution_high 2.7 _reflns.number_obs 24520 _reflns.number_all 25396 _reflns.percent_possible_obs 93.5 _reflns.pdbx_Rmerge_I_obs 0.146 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 5.5 _reflns.B_iso_Wilson_estimate 24.1 _reflns.pdbx_redundancy 4.42 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.82 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 74.5 _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 3.9 _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1F3O _refine.ls_number_reflns_obs 5971 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I 1.0 _refine.pdbx_ls_sigma_F 1.0 _refine.pdbx_data_cutoff_high_absF 1000000.00 _refine.pdbx_data_cutoff_low_absF 0.01 _refine.ls_d_res_low 30.00 _refine.ls_d_res_high 2.70 _refine.ls_percent_reflns_obs 90.9 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.204 _refine.ls_R_factor_R_free 0.277 _refine.ls_R_factor_R_free_error 0.011 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 11.1 _refine.ls_number_reflns_R_free 663 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 41.4 _refine.aniso_B[1][1] 0.09 _refine.aniso_B[2][2] 0.08 _refine.aniso_B[3][3] -0.17 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'X-Plor 3.851' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1F3O _refine_analyze.Luzzati_coordinate_error_obs 0.31 _refine_analyze.Luzzati_sigma_a_obs 0.55 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.42 _refine_analyze.Luzzati_sigma_a_free 0.97 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1835 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 1927 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 30.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.019 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.8 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 24.3 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.67 ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 6.53 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 9.65 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 9.67 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 12.75 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.70 _refine_ls_shell.d_res_low 2.82 _refine_ls_shell.number_reflns_R_work 535 _refine_ls_shell.R_factor_R_work 0.368 _refine_ls_shell.percent_reflns_obs 74.5 _refine_ls_shell.R_factor_R_free 0.456 _refine_ls_shell.R_factor_R_free_error 0.057 _refine_ls_shell.percent_reflns_R_free 10.7 _refine_ls_shell.number_reflns_R_free 64 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1F3O _struct.title 'Crystal structure of MJ0796 ATP-binding cassette' _struct.pdbx_descriptor 'HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1F3O _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS' _struct_keywords.text 'Transporter, STRUCTURAL GENOMICS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a dimer' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 43 ? GLY A 52 ? GLY A 43 GLY A 52 1 ? 10 HELX_P HELX_P2 2 ASP A 73 ? LYS A 84 ? ASP A 73 LYS A 84 1 ? 12 HELX_P HELX_P3 3 THR A 99 ? TYR A 112 ? THR A 99 TYR A 112 1 ? 14 HELX_P HELX_P4 4 SER A 117 ? ALA A 132 ? SER A 117 ALA A 132 1 ? 16 HELX_P HELX_P5 5 GLU A 135 ? ALA A 139 ? GLU A 135 ALA A 139 5 ? 5 HELX_P HELX_P6 6 LYS A 142 ? LEU A 146 ? LYS A 142 LEU A 146 5 ? 5 HELX_P HELX_P7 7 SER A 147 ? ALA A 161 ? SER A 147 ALA A 161 1 ? 15 HELX_P HELX_P8 8 ASP A 177 ? GLU A 194 ? ASP A 177 GLU A 194 1 ? 18 HELX_P HELX_P9 9 ASP A 205 ? ARG A 210 ? ASP A 205 ARG A 210 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A ILE 2 N ? ? A MSE 1 A ILE 2 1_555 ? ? ? ? ? ? ? 1.305 ? covale2 covale ? ? A LYS 12 C ? ? ? 1_555 A MSE 13 N ? ? A LYS 12 A MSE 13 1_555 ? ? ? ? ? ? ? 1.322 ? covale3 covale ? ? A MSE 13 C ? ? ? 1_555 A GLY 14 N ? ? A MSE 13 A GLY 14 1_555 ? ? ? ? ? ? ? 1.322 ? covale4 covale ? ? A ILE 36 C ? ? ? 1_555 A MSE 37 N ? ? A ILE 36 A MSE 37 1_555 ? ? ? ? ? ? ? 1.328 ? covale5 covale ? ? A MSE 37 C ? ? ? 1_555 A GLY 38 N ? ? A MSE 37 A GLY 38 1_555 ? ? ? ? ? ? ? 1.326 ? covale6 covale ? ? A THR 46 C ? ? ? 1_555 A MSE 47 N ? ? A THR 46 A MSE 47 1_555 ? ? ? ? ? ? ? 1.313 ? covale7 covale ? ? A MSE 47 C ? ? ? 1_555 A LEU 48 N ? ? A MSE 47 A LEU 48 1_555 ? ? ? ? ? ? ? 1.324 ? covale8 covale ? ? A ALA 115 C ? ? ? 1_555 A MSE 116 N ? ? A ALA 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.323 ? covale9 covale ? ? A MSE 116 C ? ? ? 1_555 A SER 117 N ? ? A MSE 116 A SER 117 1_555 ? ? ? ? ? ? ? 1.327 ? covale10 covale ? ? A LYS 130 C ? ? ? 1_555 A MSE 131 N ? ? A LYS 130 A MSE 131 1_555 ? ? ? ? ? ? ? 1.332 ? covale11 covale ? ? A MSE 131 C ? ? ? 1_555 A ALA 132 N ? ? A MSE 131 A ALA 132 1_555 ? ? ? ? ? ? ? 1.323 ? covale12 covale ? ? A ILE 184 C ? ? ? 1_555 A MSE 185 N ? ? A ILE 184 A MSE 185 1_555 ? ? ? ? ? ? ? 1.323 ? covale13 covale ? ? A MSE 185 C ? ? ? 1_555 A GLN 186 N ? ? A MSE 185 A GLN 186 1_555 ? ? ? ? ? ? ? 1.318 ? metalc1 metalc ? ? C ADP . O1B ? ? ? 1_555 B MG . MG ? ? A ADP 300 A MG 301 1_555 ? ? ? ? ? ? ? 1.975 ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 A SER 45 OG ? ? A MG 301 A SER 45 1_555 ? ? ? ? ? ? ? 1.812 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 17 ? ILE A 28 ? ILE A 17 ILE A 28 A 2 ILE A 2 ? LYS A 12 ? ILE A 2 LYS A 12 A 3 GLU A 61 ? ILE A 64 ? GLU A 61 ILE A 64 A 4 ILE A 67 ? LYS A 68 ? ILE A 67 LYS A 68 B 1 ILE A 85 ? PHE A 87 ? ILE A 85 PHE A 87 B 2 ILE A 166 ? ASP A 170 ? ILE A 166 ASP A 170 B 3 THR A 198 ? THR A 203 ? THR A 198 THR A 203 B 4 VAL A 34 ? MSE A 37 ? VAL A 34 MSE A 37 B 5 ARG A 214 ? LYS A 219 ? ARG A 214 LYS A 219 B 6 GLU A 222 ? LYS A 228 ? GLU A 222 LYS A 228 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 28 ? N ILE A 28 O ILE A 2 ? O ILE A 2 A 2 3 O LYS A 5 ? O LYS A 5 N GLU A 61 ? N GLU A 61 A 3 4 N ILE A 64 ? N ILE A 64 O ILE A 67 ? O ILE A 67 B 1 2 N GLY A 86 ? N GLY A 86 O ILE A 166 ? O ILE A 166 B 2 3 N ILE A 167 ? N ILE A 167 O THR A 198 ? O THR A 198 B 3 4 O VAL A 199 ? O VAL A 199 N VAL A 34 ? N VAL A 34 B 4 5 N SER A 35 ? N SER A 35 O ARG A 214 ? O ARG A 214 B 5 6 N LYS A 219 ? N LYS A 219 O GLU A 222 ? O GLU A 222 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG A 301' AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ADP A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 SER A 45 ? SER A 45 . ? 1_555 ? 2 AC1 2 ADP C . ? ADP A 300 . ? 1_555 ? 3 AC2 15 TYR A 11 ? TYR A 11 . ? 1_555 ? 4 AC2 15 ALA A 20 ? ALA A 20 . ? 1_555 ? 5 AC2 15 PRO A 39 ? PRO A 39 . ? 1_555 ? 6 AC2 15 SER A 40 ? SER A 40 . ? 1_555 ? 7 AC2 15 GLY A 41 ? GLY A 41 . ? 1_555 ? 8 AC2 15 SER A 42 ? SER A 42 . ? 1_555 ? 9 AC2 15 GLY A 43 ? GLY A 43 . ? 1_555 ? 10 AC2 15 LYS A 44 ? LYS A 44 . ? 1_555 ? 11 AC2 15 SER A 45 ? SER A 45 . ? 1_555 ? 12 AC2 15 THR A 46 ? THR A 46 . ? 1_555 ? 13 AC2 15 LYS A 56 ? LYS A 56 . ? 4_565 ? 14 AC2 15 ALA A 115 ? ALA A 115 . ? 5_445 ? 15 AC2 15 MG B . ? MG A 301 . ? 1_555 ? 16 AC2 15 HOH D . ? HOH A 404 . ? 1_555 ? 17 AC2 15 HOH D . ? HOH A 457 . ? 4_565 ? # _database_PDB_matrix.entry_id 1F3O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1F3O _atom_sites.fract_transf_matrix[1][1] 0.018113 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015337 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007881 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 MSE 13 13 13 MSE MSE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 MSE 37 37 37 MSE MSE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 MSE 47 47 47 MSE MSE A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 MSE 116 116 116 MSE MSE A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 MSE 131 131 131 MSE MSE A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 ASN 163 163 163 ASN ASN A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 MSE 185 185 185 MSE MSE A . n A 1 186 GLN 186 186 186 GLN GLN A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 TYR 217 217 217 TYR TYR A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 ASP 220 220 220 ASP ASP A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 VAL 223 223 223 VAL VAL A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 LYS 228 228 228 LYS LYS A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 ARG 230 230 230 ARG ARG A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 PHE 232 232 232 PHE PHE A . n A 1 233 ASP 233 233 ? ? ? A . n A 1 234 ASP 234 234 ? ? ? A . n A 1 235 ARG 235 235 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 301 301 MG MG A . C 3 ADP 1 300 300 ADP ADP A . D 4 HOH 1 401 401 HOH HOH A . D 4 HOH 2 402 402 HOH HOH A . D 4 HOH 3 403 403 HOH HOH A . D 4 HOH 4 404 404 HOH HOH A . D 4 HOH 5 405 405 HOH HOH A . D 4 HOH 6 406 406 HOH HOH A . D 4 HOH 7 407 407 HOH HOH A . D 4 HOH 8 408 408 HOH HOH A . D 4 HOH 9 409 409 HOH HOH A . D 4 HOH 10 410 410 HOH HOH A . D 4 HOH 11 411 411 HOH HOH A . D 4 HOH 12 412 412 HOH HOH A . D 4 HOH 13 413 413 HOH HOH A . D 4 HOH 14 414 414 HOH HOH A . D 4 HOH 15 415 415 HOH HOH A . D 4 HOH 16 416 416 HOH HOH A . D 4 HOH 17 417 417 HOH HOH A . D 4 HOH 18 418 418 HOH HOH A . D 4 HOH 19 419 419 HOH HOH A . D 4 HOH 20 420 420 HOH HOH A . D 4 HOH 21 421 421 HOH HOH A . D 4 HOH 22 422 422 HOH HOH A . D 4 HOH 23 423 423 HOH HOH A . D 4 HOH 24 424 424 HOH HOH A . D 4 HOH 25 425 425 HOH HOH A . D 4 HOH 26 426 426 HOH HOH A . D 4 HOH 27 427 427 HOH HOH A . D 4 HOH 28 428 428 HOH HOH A . D 4 HOH 29 429 429 HOH HOH A . D 4 HOH 30 430 430 HOH HOH A . D 4 HOH 31 431 431 HOH HOH A . D 4 HOH 32 432 432 HOH HOH A . D 4 HOH 33 433 433 HOH HOH A . D 4 HOH 34 434 434 HOH HOH A . D 4 HOH 35 435 435 HOH HOH A . D 4 HOH 36 436 436 HOH HOH A . D 4 HOH 37 437 437 HOH HOH A . D 4 HOH 38 438 438 HOH HOH A . D 4 HOH 39 439 439 HOH HOH A . D 4 HOH 40 440 440 HOH HOH A . D 4 HOH 41 441 441 HOH HOH A . D 4 HOH 42 442 442 HOH HOH A . D 4 HOH 43 443 443 HOH HOH A . D 4 HOH 44 444 444 HOH HOH A . D 4 HOH 45 445 445 HOH HOH A . D 4 HOH 46 446 446 HOH HOH A . D 4 HOH 47 447 447 HOH HOH A . D 4 HOH 48 448 448 HOH HOH A . D 4 HOH 49 449 449 HOH HOH A . D 4 HOH 50 450 450 HOH HOH A . D 4 HOH 51 451 451 HOH HOH A . D 4 HOH 52 452 452 HOH HOH A . D 4 HOH 53 453 453 HOH HOH A . D 4 HOH 54 454 454 HOH HOH A . D 4 HOH 55 455 455 HOH HOH A . D 4 HOH 56 456 456 HOH HOH A . D 4 HOH 57 457 457 HOH HOH A . D 4 HOH 58 458 458 HOH HOH A . D 4 HOH 59 459 459 HOH HOH A . D 4 HOH 60 460 460 HOH HOH A . D 4 HOH 61 461 461 HOH HOH A . D 4 HOH 62 462 462 HOH HOH A . D 4 HOH 63 463 463 HOH HOH A . D 4 HOH 64 464 464 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 13 A MSE 13 ? MET SELENOMETHIONINE 3 A MSE 37 A MSE 37 ? MET SELENOMETHIONINE 4 A MSE 47 A MSE 47 ? MET SELENOMETHIONINE 5 A MSE 116 A MSE 116 ? MET SELENOMETHIONINE 6 A MSE 131 A MSE 131 ? MET SELENOMETHIONINE 7 A MSE 185 A MSE 185 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_565 x,-y+1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 65.2000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id O1B _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id C _pdbx_struct_conn_angle.ptnr1_label_comp_id ADP _pdbx_struct_conn_angle.ptnr1_label_seq_id . _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id ADP _pdbx_struct_conn_angle.ptnr1_auth_seq_id 300 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id MG _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id MG _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id MG _pdbx_struct_conn_angle.ptnr2_auth_seq_id 301 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id OG _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id SER _pdbx_struct_conn_angle.ptnr3_label_seq_id 45 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id SER _pdbx_struct_conn_angle.ptnr3_auth_seq_id 45 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 85.8 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-07-25 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Experimental preparation' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category exptl_crystal_grow # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_exptl_crystal_grow.temp' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 SOLVE phasing . ? 3 X-PLOR refinement 3.851 ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 225 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 227 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.05 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A GLU 15 ? ? CD A GLU 15 ? ? 1.621 1.515 0.106 0.015 N 2 1 CD A GLU 15 ? ? OE2 A GLU 15 ? ? 1.322 1.252 0.070 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A MSE 1 ? ? CB A MSE 1 ? ? CG A MSE 1 ? ? 97.13 113.30 -16.17 1.70 N 2 1 NE A ARG 122 ? ? CZ A ARG 122 ? ? NH1 A ARG 122 ? ? 123.73 120.30 3.43 0.50 N 3 1 NE A ARG 122 ? ? CZ A ARG 122 ? ? NH2 A ARG 122 ? ? 116.32 120.30 -3.98 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 23 ? ? 33.62 48.36 2 1 ASN A 27 ? ? -164.08 106.56 3 1 LYS A 44 ? ? -47.80 -71.57 4 1 GLU A 59 ? ? -168.84 -167.56 5 1 ASN A 66 ? ? 75.54 -0.08 6 1 ASN A 93 ? ? 71.74 33.35 7 1 TYR A 112 ? ? -109.37 41.04 8 1 PRO A 143 ? ? -38.60 -77.79 9 1 ASN A 144 ? ? -54.02 0.11 10 1 GLU A 194 ? ? -90.17 -60.59 11 1 ARG A 230 ? ? -134.92 -62.00 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id GLU _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 15 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.076 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 233 ? A ASP 233 2 1 Y 1 A ASP 234 ? A ASP 234 3 1 Y 1 A ARG 235 ? A ARG 235 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 "ADENOSINE-5'-DIPHOSPHATE" ADP 4 water HOH #