data_1F8Z # _entry.id 1F8Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1F8Z pdb_00001f8z 10.2210/pdb1f8z/pdb RCSB RCSB011390 ? ? WWPDB D_1000011390 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1LDL '1LDL contains the first ligand-binding module of the LDL receptor' unspecified PDB 1LDR '1LDR contains the second ligand-binding module of the LDL receptor' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F8Z _pdbx_database_status.recvd_initial_deposition_date 2000-07-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clayton, D.J.' 1 'Brereton, I.M.' 2 'Kroon, P.A.' 3 'Smith, R.' 4 # _citation.id primary _citation.title ;Three-dimensional NMR structure of the sixth ligand-binding module of the human LDL receptor: comparison of two adjacent modules with different ligand binding specificities. ; _citation.journal_abbrev 'FEBS Lett.' _citation.journal_volume 479 _citation.page_first 118 _citation.page_last 122 _citation.year 2000 _citation.journal_id_ASTM FEBLAL _citation.country NE _citation.journal_id_ISSN 0014-5793 _citation.journal_id_CSD 0165 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10981718 _citation.pdbx_database_id_DOI '10.1016/S0014-5793(00)01842-1' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Clayton, D.' 1 ? primary 'Brereton, I.M.' 2 ? primary 'Kroon, P.A.' 3 ? primary 'Smith, R.' 4 ? # _cell.entry_id 1F8Z _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1F8Z _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'LOW-DENSITY LIPOPROTEIN RECEPTOR' 4392.759 1 ? ? 'SIXTH LIGAND-BINDING MODULE' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVN _entity_poly.pdbx_seq_one_letter_code_can ATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 CYS n 1 4 ARG n 1 5 PRO n 1 6 ASP n 1 7 GLU n 1 8 PHE n 1 9 GLN n 1 10 CYS n 1 11 SER n 1 12 ASP n 1 13 GLY n 1 14 ASN n 1 15 CYS n 1 16 ILE n 1 17 HIS n 1 18 GLY n 1 19 SER n 1 20 ARG n 1 21 GLN n 1 22 CYS n 1 23 ASP n 1 24 ARG n 1 25 GLU n 1 26 TYR n 1 27 ASP n 1 28 CYS n 1 29 LYS n 1 30 ASP n 1 31 MET n 1 32 SER n 1 33 ASP n 1 34 GLU n 1 35 VAL n 1 36 GLY n 1 37 CYS n 1 38 VAL n 1 39 ASN n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'Peptide synthesis - based on the human sequence' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LDLR_HUMAN _struct_ref.pdbx_db_accession P01130 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVN _struct_ref.pdbx_align_begin 234 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1F8Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01130 _struct_ref_seq.db_align_beg 234 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 272 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 39 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 DQF-COSY 3 2 1 E-COSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.50 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '3 mM LB6, 10 mM CaCl2, 1 mM 3,3,3-trimethylsilylpropionate' '90% H2O/10% D2O' 2 '3 mM LB6, 10 mM CaCl2, 1 mM 3,3,3-trimethylsilylpropionate' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 750 # _pdbx_nmr_refine.entry_id 1F8Z _pdbx_nmr_refine.method ;Structure determination by Torsion angle dynamics, Molecular dynamics ; _pdbx_nmr_refine.details ;Structures are based on 552 distance constraints, 18 backbone angle restraints and 14 sidechain angle restraints ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1F8Z _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR ? collection Bruker 1 AURELIA ? processing Bruker 2 XEASY ? processing 'Xia & Bartels' 3 DYANA 1.5 'structure solution' 'Peter Guntert' 4 X-PLOR 3.1 'structure solution' 'Axel Brunger' 5 X-PLOR 3.1 refinement 'Axel Brunger' 6 # _exptl.entry_id 1F8Z _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1F8Z _struct.title 'NMR STRUCTURE OF THE SIXTH LIGAND-BINDING MODULE OF THE LDL RECEPTOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1F8Z _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text 'LDL receptor, ligand-binding domain, calcium-binding, familial hypercholesterolemia, LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id MET _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 31 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 35 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id MET _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 31 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 35 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 3 A CYS 15 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 10 A CYS 28 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 22 A CYS 37 1_555 ? ? ? ? ? ? ? 2.020 ? ? metalc1 metalc ? ? A ARG 20 O ? ? ? 1_555 B CA . CA ? ? A ARG 20 A CA 40 1_555 ? ? ? ? ? ? ? 2.791 ? ? metalc2 metalc ? ? A ASP 23 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 23 A CA 40 1_555 ? ? ? ? ? ? ? 2.647 ? ? metalc3 metalc ? ? A GLU 25 O ? ? ? 1_555 B CA . CA ? ? A GLU 25 A CA 40 1_555 ? ? ? ? ? ? ? 3.186 ? ? metalc4 metalc ? ? A GLU 25 N ? ? ? 1_555 B CA . CA ? ? A GLU 25 A CA 40 1_555 ? ? ? ? ? ? ? 3.021 ? ? metalc5 metalc ? ? A TYR 26 N ? ? ? 1_555 B CA . CA ? ? A TYR 26 A CA 40 1_555 ? ? ? ? ? ? ? 3.248 ? ? metalc6 metalc ? ? A ASP 27 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 27 A CA 40 1_555 ? ? ? ? ? ? ? 2.635 ? ? metalc7 metalc ? ? A ASP 33 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 33 A CA 40 1_555 ? ? ? ? ? ? ? 2.632 ? ? metalc8 metalc ? ? A GLU 34 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 34 A CA 40 1_555 ? ? ? ? ? ? ? 2.619 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 7 ? GLN A 9 ? GLU A 7 GLN A 9 A 2 CYS A 15 ? HIS A 17 ? CYS A 15 HIS A 17 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 8 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 8 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 16 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 16 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 40 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 40' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ARG A 20 ? ARG A 20 . ? 1_555 ? 2 AC1 7 ASP A 23 ? ASP A 23 . ? 1_555 ? 3 AC1 7 GLU A 25 ? GLU A 25 . ? 1_555 ? 4 AC1 7 TYR A 26 ? TYR A 26 . ? 1_555 ? 5 AC1 7 ASP A 27 ? ASP A 27 . ? 1_555 ? 6 AC1 7 ASP A 33 ? ASP A 33 . ? 1_555 ? 7 AC1 7 GLU A 34 ? GLU A 34 . ? 1_555 ? # _database_PDB_matrix.entry_id 1F8Z _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1F8Z _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASN 39 39 39 ASN ASN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 40 _pdbx_nonpoly_scheme.auth_seq_num 40 _pdbx_nonpoly_scheme.pdb_mon_id CA _pdbx_nonpoly_scheme.auth_mon_id CA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ARG 20 ? A ARG 20 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 61.5 ? 2 O ? A ARG 20 ? A ARG 20 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 O ? A GLU 25 ? A GLU 25 ? 1_555 138.9 ? 3 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 O ? A GLU 25 ? A GLU 25 ? 1_555 117.7 ? 4 O ? A ARG 20 ? A ARG 20 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 N ? A GLU 25 ? A GLU 25 ? 1_555 129.9 ? 5 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 N ? A GLU 25 ? A GLU 25 ? 1_555 68.5 ? 6 O ? A GLU 25 ? A GLU 25 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 N ? A GLU 25 ? A GLU 25 ? 1_555 69.3 ? 7 O ? A ARG 20 ? A ARG 20 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 N ? A TYR 26 ? A TYR 26 ? 1_555 179.5 ? 8 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 N ? A TYR 26 ? A TYR 26 ? 1_555 118.0 ? 9 O ? A GLU 25 ? A GLU 25 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 N ? A TYR 26 ? A TYR 26 ? 1_555 41.0 ? 10 N ? A GLU 25 ? A GLU 25 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 N ? A TYR 26 ? A TYR 26 ? 1_555 49.7 ? 11 O ? A ARG 20 ? A ARG 20 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD2 ? A ASP 27 ? A ASP 27 ? 1_555 62.9 ? 12 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD2 ? A ASP 27 ? A ASP 27 ? 1_555 113.1 ? 13 O ? A GLU 25 ? A GLU 25 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD2 ? A ASP 27 ? A ASP 27 ? 1_555 84.2 ? 14 N ? A GLU 25 ? A GLU 25 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD2 ? A ASP 27 ? A ASP 27 ? 1_555 148.8 ? 15 N ? A TYR 26 ? A TYR 26 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD2 ? A ASP 27 ? A ASP 27 ? 1_555 117.3 ? 16 O ? A ARG 20 ? A ARG 20 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD2 ? A ASP 33 ? A ASP 33 ? 1_555 87.2 ? 17 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD2 ? A ASP 33 ? A ASP 33 ? 1_555 140.9 ? 18 O ? A GLU 25 ? A GLU 25 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD2 ? A ASP 33 ? A ASP 33 ? 1_555 101.2 ? 19 N ? A GLU 25 ? A GLU 25 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD2 ? A ASP 33 ? A ASP 33 ? 1_555 134.6 ? 20 N ? A TYR 26 ? A TYR 26 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD2 ? A ASP 33 ? A ASP 33 ? 1_555 93.3 ? 21 OD2 ? A ASP 27 ? A ASP 27 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OD2 ? A ASP 33 ? A ASP 33 ? 1_555 65.0 ? 22 O ? A ARG 20 ? A ARG 20 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OE2 ? A GLU 34 ? A GLU 34 ? 1_555 70.2 ? 23 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OE2 ? A GLU 34 ? A GLU 34 ? 1_555 66.2 ? 24 O ? A GLU 25 ? A GLU 25 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OE2 ? A GLU 34 ? A GLU 34 ? 1_555 150.4 ? 25 N ? A GLU 25 ? A GLU 25 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OE2 ? A GLU 34 ? A GLU 34 ? 1_555 87.3 ? 26 N ? A TYR 26 ? A TYR 26 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OE2 ? A GLU 34 ? A GLU 34 ? 1_555 109.8 ? 27 OD2 ? A ASP 27 ? A ASP 27 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OE2 ? A GLU 34 ? A GLU 34 ? 1_555 122.7 ? 28 OD2 ? A ASP 33 ? A ASP 33 ? 1_555 CA ? B CA . ? A CA 40 ? 1_555 OE2 ? A GLU 34 ? A GLU 34 ? 1_555 82.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-10-18 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 29 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 30 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 15 ? ? CB A CYS 15 ? ? SG A CYS 15 ? ? 120.90 114.20 6.70 1.10 N 2 1 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.86 114.20 7.66 1.10 N 3 2 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 122.04 114.20 7.84 1.10 N 4 3 CA A CYS 15 ? ? CB A CYS 15 ? ? SG A CYS 15 ? ? 120.98 114.20 6.78 1.10 N 5 3 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.42 114.20 7.22 1.10 N 6 4 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.00 114.20 6.80 1.10 N 7 6 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH2 A ARG 20 ? ? 117.25 120.30 -3.05 0.50 N 8 7 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 122.03 114.20 7.83 1.10 N 9 8 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.67 114.20 7.47 1.10 N 10 9 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.54 114.20 7.34 1.10 N 11 11 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.68 114.20 7.48 1.10 N 12 12 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.51 114.20 7.31 1.10 N 13 13 CA A CYS 15 ? ? CB A CYS 15 ? ? SG A CYS 15 ? ? 121.23 114.20 7.03 1.10 N 14 13 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.07 114.20 6.87 1.10 N 15 14 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 122.04 114.20 7.84 1.10 N 16 15 CA A CYS 15 ? ? CB A CYS 15 ? ? SG A CYS 15 ? ? 121.42 114.20 7.22 1.10 N 17 15 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 122.48 114.20 8.28 1.10 N 18 16 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.65 114.20 7.45 1.10 N 19 17 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 122.50 114.20 8.30 1.10 N 20 18 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.85 114.20 7.65 1.10 N 21 19 CA A CYS 15 ? ? CB A CYS 15 ? ? SG A CYS 15 ? ? 120.89 114.20 6.69 1.10 N 22 19 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.48 114.20 7.28 1.10 N 23 20 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 121.91 114.20 7.71 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 23 ? ? -150.33 3.39 2 1 GLU A 25 ? ? -92.60 38.03 3 1 TYR A 26 ? ? -2.20 75.85 4 1 MET A 31 ? ? 56.81 17.15 5 2 CYS A 22 ? ? 68.06 63.86 6 2 ASP A 23 ? ? -150.42 9.97 7 2 ARG A 24 ? ? 43.10 28.23 8 2 GLU A 25 ? ? -101.65 41.38 9 2 TYR A 26 ? ? 1.07 80.39 10 2 MET A 31 ? ? 55.80 17.41 11 3 ASP A 23 ? ? -150.61 3.64 12 3 GLU A 25 ? ? -93.95 39.82 13 3 TYR A 26 ? ? -3.96 79.06 14 3 MET A 31 ? ? 51.23 11.17 15 4 ASP A 23 ? ? -141.70 -5.07 16 4 GLU A 25 ? ? -98.48 44.71 17 4 TYR A 26 ? ? -2.60 82.95 18 4 MET A 31 ? ? 46.11 16.46 19 5 CYS A 22 ? ? 67.67 65.00 20 5 ASP A 23 ? ? -150.48 1.11 21 5 GLU A 25 ? ? -89.99 40.48 22 5 TYR A 26 ? ? 1.40 76.31 23 5 MET A 31 ? ? 57.51 12.54 24 5 VAL A 38 ? ? -102.93 46.80 25 6 ASP A 23 ? ? -150.18 2.49 26 6 GLU A 25 ? ? -98.37 43.65 27 6 TYR A 26 ? ? -3.66 83.97 28 6 MET A 31 ? ? 53.72 14.48 29 6 CYS A 37 ? ? -52.57 -75.50 30 7 ASP A 23 ? ? -150.45 6.44 31 7 ARG A 24 ? ? 48.95 29.96 32 7 GLU A 25 ? ? -92.29 41.92 33 7 TYR A 26 ? ? -5.74 79.79 34 7 MET A 31 ? ? 59.42 15.90 35 8 ASP A 23 ? ? -150.60 6.64 36 8 GLU A 25 ? ? -92.12 41.76 37 8 TYR A 26 ? ? -6.52 76.96 38 8 MET A 31 ? ? 54.65 13.40 39 8 VAL A 38 ? ? -95.19 43.16 40 9 ASP A 23 ? ? -150.43 9.32 41 9 GLU A 25 ? ? -97.83 45.38 42 9 TYR A 26 ? ? -11.39 85.73 43 9 MET A 31 ? ? 52.17 15.65 44 10 ASP A 23 ? ? -150.56 12.17 45 10 ARG A 24 ? ? 39.90 33.62 46 10 GLU A 25 ? ? -96.73 40.15 47 10 TYR A 26 ? ? 1.36 76.82 48 10 CYS A 37 ? ? -68.87 -73.42 49 11 CYS A 22 ? ? 63.48 61.59 50 11 ASP A 23 ? ? -143.53 -0.20 51 11 ARG A 24 ? ? 45.09 26.95 52 11 GLU A 25 ? ? -100.53 46.36 53 11 TYR A 26 ? ? 4.29 76.68 54 11 MET A 31 ? ? 58.40 13.17 55 12 ASP A 23 ? ? -150.64 3.58 56 12 GLU A 25 ? ? -92.16 39.62 57 12 TYR A 26 ? ? -2.35 76.68 58 12 MET A 31 ? ? 54.76 16.26 59 13 ASP A 23 ? ? -150.37 6.45 60 13 GLU A 25 ? ? -94.34 40.16 61 13 TYR A 26 ? ? -3.44 77.92 62 13 MET A 31 ? ? 57.21 13.28 63 14 CYS A 22 ? ? 65.18 60.04 64 14 ASP A 23 ? ? -150.28 8.03 65 14 ARG A 24 ? ? 44.39 29.93 66 14 GLU A 25 ? ? -94.76 42.91 67 14 TYR A 26 ? ? -2.94 78.90 68 14 MET A 31 ? ? 55.99 13.62 69 15 CYS A 22 ? ? 67.70 60.85 70 15 ASP A 23 ? ? -142.34 -5.38 71 15 GLU A 25 ? ? -99.93 41.58 72 15 TYR A 26 ? ? 9.76 70.78 73 15 CYS A 37 ? ? -77.36 -74.32 74 15 VAL A 38 ? ? -101.35 45.94 75 16 ASP A 23 ? ? -150.52 2.85 76 16 GLU A 25 ? ? -94.19 42.76 77 16 TYR A 26 ? ? -6.25 82.72 78 16 MET A 31 ? ? 51.23 13.45 79 17 CYS A 22 ? ? 65.39 60.08 80 17 ASP A 23 ? ? -147.49 -4.39 81 17 GLU A 25 ? ? -96.77 36.00 82 17 TYR A 26 ? ? 5.84 73.87 83 17 MET A 31 ? ? 59.13 14.72 84 17 CYS A 37 ? ? -59.53 -71.94 85 17 VAL A 38 ? ? -96.40 43.35 86 18 ASP A 23 ? ? -150.39 5.47 87 18 GLU A 25 ? ? -93.98 41.45 88 18 TYR A 26 ? ? -5.40 77.35 89 18 MET A 31 ? ? 55.44 15.89 90 19 ASP A 23 ? ? -150.36 4.65 91 19 GLU A 25 ? ? -93.93 39.35 92 19 TYR A 26 ? ? 0.35 76.89 93 19 MET A 31 ? ? 56.49 14.36 94 20 GLU A 25 ? ? -98.49 44.69 95 20 TYR A 26 ? ? -11.66 80.12 96 20 MET A 31 ? ? 57.42 6.67 97 20 CYS A 37 ? ? -69.01 -70.49 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #