data_1FP0 # _entry.id 1FP0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FP0 pdb_00001fp0 10.2210/pdb1fp0/pdb RCSB RCSB011783 ? ? WWPDB D_1000011783 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FP0 _pdbx_database_status.recvd_initial_deposition_date 2000-08-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Capili, A.D.' 1 'Schultz, D.C.' 2 'Rauscher III, F.J.' 3 'Borden, K.L.B.' 4 # _citation.id primary _citation.title ;Solution structure of the PHD domain from the KAP-1 corepressor: structural determinants for PHD, RING and LIM zinc-binding domains. ; _citation.journal_abbrev 'EMBO J.' _citation.journal_volume 20 _citation.page_first 165 _citation.page_last 177 _citation.year 2001 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11226167 _citation.pdbx_database_id_DOI 10.1093/emboj/20.1.165 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Capili, A.D.' 1 ? primary 'Schultz, D.C.' 2 ? primary 'RauscherIII, F.J.' 3 ? primary 'Borden, K.L.' 4 ? # _cell.entry_id 1FP0 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FP0 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'KAP-1 COREPRESSOR' 9939.204 1 ? ? 'PHD DOMAIN' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TRANSCRIPTION INTERMEDIARY FACTOR 1-BETA, NUCLEAR COREPRESSOR, KAP-1, KRAB-ASSOCIATED PROTEIN 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHGSDIIDEFGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDV DLQACKLN ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHGSDIIDEFGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDV DLQACKLN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 SER n 1 13 ASP n 1 14 ILE n 1 15 ILE n 1 16 ASP n 1 17 GLU n 1 18 PHE n 1 19 GLY n 1 20 THR n 1 21 LEU n 1 22 ASP n 1 23 ASP n 1 24 SER n 1 25 ALA n 1 26 THR n 1 27 ILE n 1 28 CYS n 1 29 ARG n 1 30 VAL n 1 31 CYS n 1 32 GLN n 1 33 LYS n 1 34 PRO n 1 35 GLY n 1 36 ASP n 1 37 LEU n 1 38 VAL n 1 39 MET n 1 40 CYS n 1 41 ASN n 1 42 GLN n 1 43 CYS n 1 44 GLU n 1 45 PHE n 1 46 CYS n 1 47 PHE n 1 48 HIS n 1 49 LEU n 1 50 ASP n 1 51 CYS n 1 52 HIS n 1 53 LEU n 1 54 PRO n 1 55 ALA n 1 56 LEU n 1 57 GLN n 1 58 ASP n 1 59 VAL n 1 60 PRO n 1 61 GLY n 1 62 GLU n 1 63 GLU n 1 64 TRP n 1 65 SER n 1 66 CYS n 1 67 SER n 1 68 LEU n 1 69 CYS n 1 70 HIS n 1 71 VAL n 1 72 LEU n 1 73 PRO n 1 74 ASP n 1 75 LEU n 1 76 LYS n 1 77 GLU n 1 78 GLU n 1 79 ASP n 1 80 VAL n 1 81 ASP n 1 82 LEU n 1 83 GLN n 1 84 ALA n 1 85 CYS n 1 86 LYS n 1 87 LEU n 1 88 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PQE50 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code TIF1B_HUMAN _struct_ref.pdbx_db_accession Q13263 _struct_ref.pdbx_align_begin 619 _struct_ref.pdbx_seq_one_letter_code GTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEED _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FP0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 19 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13263 _struct_ref_seq.db_align_beg 619 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 679 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 19 _struct_ref_seq.pdbx_auth_seq_align_end 79 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1FP0 MET A 1 ? UNP Q13263 ? ? 'expression tag' 1 1 1 1FP0 ARG A 2 ? UNP Q13263 ? ? 'expression tag' 2 2 1 1FP0 GLY A 3 ? UNP Q13263 ? ? 'expression tag' 3 3 1 1FP0 SER A 4 ? UNP Q13263 ? ? 'expression tag' 4 4 1 1FP0 HIS A 5 ? UNP Q13263 ? ? 'expression tag' 5 5 1 1FP0 HIS A 6 ? UNP Q13263 ? ? 'expression tag' 6 6 1 1FP0 HIS A 7 ? UNP Q13263 ? ? 'expression tag' 7 7 1 1FP0 HIS A 8 ? UNP Q13263 ? ? 'expression tag' 8 8 1 1FP0 HIS A 9 ? UNP Q13263 ? ? 'expression tag' 9 9 1 1FP0 HIS A 10 ? UNP Q13263 ? ? 'expression tag' 10 10 1 1FP0 GLY A 11 ? UNP Q13263 ? ? 'expression tag' 11 11 1 1FP0 SER A 12 ? UNP Q13263 ? ? 'expression tag' 12 12 1 1FP0 ASP A 13 ? UNP Q13263 ? ? 'expression tag' 13 13 1 1FP0 ILE A 14 ? UNP Q13263 ? ? 'expression tag' 14 14 1 1FP0 ILE A 15 ? UNP Q13263 ? ? 'expression tag' 15 15 1 1FP0 ASP A 16 ? UNP Q13263 ? ? 'expression tag' 16 16 1 1FP0 GLU A 17 ? UNP Q13263 ? ? 'expression tag' 17 17 1 1FP0 PHE A 18 ? UNP Q13263 ? ? 'expression tag' 18 18 1 1FP0 VAL A 80 ? UNP Q13263 ? ? 'cloning artifact' 80 19 1 1FP0 ASP A 81 ? UNP Q13263 ? ? 'cloning artifact' 81 20 1 1FP0 LEU A 82 ? UNP Q13263 ? ? 'cloning artifact' 82 21 1 1FP0 GLN A 83 ? UNP Q13263 ? ? 'cloning artifact' 83 22 1 1FP0 ALA A 84 ? UNP Q13263 ? ? 'cloning artifact' 84 23 1 1FP0 CYS A 85 ? UNP Q13263 ? ? 'cloning artifact' 85 24 1 1FP0 LYS A 86 ? UNP Q13263 ? ? 'cloning artifact' 86 25 1 1FP0 LEU A 87 ? UNP Q13263 ? ? 'cloning artifact' 87 26 1 1FP0 ASN A 88 ? UNP Q13263 ? ? 'cloning artifact' 88 27 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.50 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 ;1.5-3.0 mM 15N-labelled or unlabelled KAP-1 PHD, 20 mM NaH2PO4, 500 mM NaCl, 5 mM DTT, pH 7.5 ; '90% H2O/10% D2O' 2 '1.5-3.0 mM unlabelled KAP-1 PHD, 20 mM NaH2PO4, 500 mM NaCl, 5 mM DTT, pH 7.5' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1FP0 _pdbx_nmr_refine.method 'distance geometry and simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1FP0 _pdbx_nmr_details.text ;First 17 residues (MRGSHHHHHHGSDIIDE) and last 9 residues (VDLQACKLN) do not belong to the natural protein molecule, residues 618 to 679 corresponds to KAP-1, structured region corresponds to residues 627-670 which contain the PHD domain ; # _pdbx_nmr_ensemble.entry_id 1FP0 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1FP0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.851 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.authors Brunger _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1FP0 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1FP0 _struct.title 'SOLUTION STRUCTURE OF THE PHD DOMAIN FROM THE KAP-1 COREPRESSOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FP0 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'PHD domain, C3HC4 type zinc binding domain, NMR-structure, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 28 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 28 A ZN 90 1_555 ? ? ? ? ? ? ? 2.344 ? ? metalc2 metalc ? ? A CYS 31 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 31 A ZN 90 1_555 ? ? ? ? ? ? ? 2.312 ? ? metalc3 metalc ? ? A CYS 40 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 40 A ZN 89 1_555 ? ? ? ? ? ? ? 2.276 ? ? metalc4 metalc ? ? A CYS 43 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 43 A ZN 89 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc5 metalc ? ? A HIS 48 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 48 A ZN 90 1_555 ? ? ? ? ? ? ? 1.977 ? ? metalc6 metalc ? ? A CYS 51 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 51 A ZN 90 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc7 metalc ? ? A CYS 66 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 66 A ZN 89 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc8 metalc ? ? A CYS 69 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 69 A ZN 89 1_555 ? ? ? ? ? ? ? 2.299 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 38 ? CYS A 40 ? VAL A 38 CYS A 40 A 2 PHE A 45 ? PHE A 47 ? PHE A 45 PHE A 47 A 3 TRP A 64 ? SER A 67 ? TRP A 64 SER A 67 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 38 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 38 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 47 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 47 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 89 ? 5 'BINDING SITE FOR RESIDUE ZN A 89' AC2 Software A ZN 90 ? 6 'BINDING SITE FOR RESIDUE ZN A 90' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 40 ? CYS A 40 . ? 1_555 ? 2 AC1 5 GLN A 42 ? GLN A 42 . ? 1_555 ? 3 AC1 5 CYS A 43 ? CYS A 43 . ? 1_555 ? 4 AC1 5 CYS A 66 ? CYS A 66 . ? 1_555 ? 5 AC1 5 CYS A 69 ? CYS A 69 . ? 1_555 ? 6 AC2 6 CYS A 28 ? CYS A 28 . ? 1_555 ? 7 AC2 6 VAL A 30 ? VAL A 30 . ? 1_555 ? 8 AC2 6 CYS A 31 ? CYS A 31 . ? 1_555 ? 9 AC2 6 PHE A 47 ? PHE A 47 . ? 1_555 ? 10 AC2 6 HIS A 48 ? HIS A 48 . ? 1_555 ? 11 AC2 6 CYS A 51 ? CYS A 51 . ? 1_555 ? # _database_PDB_matrix.entry_id 1FP0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FP0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 TRP 64 64 64 TRP TRP A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASN 88 88 88 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 89 89 ZN ZN A . C 2 ZN 1 90 90 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 112.0 ? 2 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 ND1 ? A HIS 48 ? A HIS 48 ? 1_555 109.9 ? 3 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 ND1 ? A HIS 48 ? A HIS 48 ? 1_555 108.3 ? 4 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 110.9 ? 5 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 108.6 ? 6 ND1 ? A HIS 48 ? A HIS 48 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 107.0 ? 7 SG ? A CYS 40 ? A CYS 40 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 106.4 ? 8 SG ? A CYS 40 ? A CYS 40 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 SG ? A CYS 66 ? A CYS 66 ? 1_555 111.0 ? 9 SG ? A CYS 43 ? A CYS 43 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 SG ? A CYS 66 ? A CYS 66 ? 1_555 110.2 ? 10 SG ? A CYS 40 ? A CYS 40 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 109.5 ? 11 SG ? A CYS 43 ? A CYS 43 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 109.1 ? 12 SG ? A CYS 66 ? A CYS 66 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 110.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-01-24 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 53 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ALA _pdbx_validate_close_contact.auth_seq_id_2 55 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 4 ? ? -163.05 30.42 2 1 HIS A 8 ? ? 55.89 175.68 3 1 HIS A 9 ? ? -146.37 -143.53 4 1 HIS A 10 ? ? -41.93 -82.44 5 1 ASP A 13 ? ? 178.08 -50.47 6 1 ILE A 14 ? ? 80.02 -24.91 7 1 ILE A 15 ? ? 57.47 121.06 8 1 THR A 20 ? ? 38.56 34.63 9 1 LEU A 21 ? ? -139.57 -71.38 10 1 ASP A 22 ? ? -81.86 -150.67 11 1 ASP A 23 ? ? 55.51 19.81 12 1 SER A 24 ? ? 178.03 178.38 13 1 ALA A 25 ? ? 70.64 -135.38 14 1 THR A 26 ? ? -39.89 170.30 15 1 CYS A 31 ? ? -160.21 -41.12 16 1 LYS A 33 ? ? -140.88 -66.55 17 1 ASP A 36 ? ? 44.28 104.18 18 1 LEU A 37 ? ? -168.35 105.86 19 1 ASN A 41 ? ? -69.34 5.58 20 1 CYS A 43 ? ? -153.92 -84.51 21 1 GLU A 44 ? ? -175.95 33.37 22 1 PHE A 47 ? ? -139.06 -157.40 23 1 LEU A 49 ? ? -69.49 9.08 24 1 HIS A 52 ? ? -88.79 -87.31 25 1 PRO A 54 ? ? -63.22 63.90 26 1 ALA A 55 ? ? 177.18 42.52 27 1 GLU A 62 ? ? 58.73 -108.90 28 1 GLU A 63 ? ? -99.66 -151.36 29 1 TRP A 64 ? ? -74.91 -102.24 30 1 SER A 65 ? ? 172.62 37.42 31 1 CYS A 66 ? ? 57.50 163.62 32 1 SER A 67 ? ? -135.06 -141.70 33 1 VAL A 71 ? ? -111.23 52.71 34 1 CYS A 85 ? ? -59.14 -144.70 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 2 ? ? 0.279 'SIDE CHAIN' 2 1 ARG A 29 ? ? 0.317 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #