data_1FW0 # _entry.id 1FW0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.283 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1FW0 RCSB RCSB011948 WWPDB D_1000011948 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1GR2 'GluR2 S1S2I in Complex with Kainate' unspecified PDB 1FTJ 'GluR2 S1S2J in Complex with Glutamate' unspecified PDB 1FTK 'GluR2 S1S2I in Complex with Kainate' unspecified PDB 1FTL 'GluR2 S1S2J in Complex with DNQX' unspecified PDB 1FTM 'GluR2 S1S2J in Complex with AMPA' unspecified PDB 1FTO 'GluR2 S1S2J in the Apo State' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FW0 _pdbx_database_status.recvd_initial_deposition_date 2000-09-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Armstrong, N.' 1 'Gouaux, E.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Mechanisms for activation and antagonism of an AMPA-sensitive glutamate receptor: crystal structures of the GluR2 ligand binding core. ; Neuron 28 165 181 2000 NERNET US 0896-6273 2038 ? 11086992 '10.1016/S0896-6273(00)00094-5' 1 ;Probing the ligand binding domain of the GluR2 receptor by proteolysis and deletion mutagenesis defines domain boundaries and yields a crystallizable construct ; 'Protein Sci.' 7 2623 2630 1998 PRCIEI US 0961-8368 0795 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Armstrong, N.' 1 primary 'Gouaux, E.' 2 1 'Chen, G.Q.' 3 1 'Sun, Y.' 4 1 'Jin, R.' 5 1 'Gouaux, E.' 6 # _cell.entry_id 1FW0 _cell.length_a 57.279 _cell.length_b 89.014 _cell.length_c 48.873 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FW0 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GLUTAMATE RECEPTOR SUBUNIT 2' 29221.682 1 ? ? 'LIGAND BINDING CORE (S1S2J)' ? 2 non-polymer syn '3-(CARBOXYMETHYL)-4-ISOPROPENYLPROLINE' 213.230 1 ? ? ? ? 3 water nat water 18.015 78 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name GLUR-2 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GANKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVY GKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWT YMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLK LNEQGLLDKLKNKWWYDKGECGS ; _entity_poly.pdbx_seq_one_letter_code_can ;GANKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVY GKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWT YMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLK LNEQGLLDKLKNKWWYDKGECGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 ASN n 1 4 LYS n 1 5 THR n 1 6 VAL n 1 7 VAL n 1 8 VAL n 1 9 THR n 1 10 THR n 1 11 ILE n 1 12 LEU n 1 13 GLU n 1 14 SER n 1 15 PRO n 1 16 TYR n 1 17 VAL n 1 18 MET n 1 19 MET n 1 20 LYS n 1 21 LYS n 1 22 ASN n 1 23 HIS n 1 24 GLU n 1 25 MET n 1 26 LEU n 1 27 GLU n 1 28 GLY n 1 29 ASN n 1 30 GLU n 1 31 ARG n 1 32 TYR n 1 33 GLU n 1 34 GLY n 1 35 TYR n 1 36 CYS n 1 37 VAL n 1 38 ASP n 1 39 LEU n 1 40 ALA n 1 41 ALA n 1 42 GLU n 1 43 ILE n 1 44 ALA n 1 45 LYS n 1 46 HIS n 1 47 CYS n 1 48 GLY n 1 49 PHE n 1 50 LYS n 1 51 TYR n 1 52 LYS n 1 53 LEU n 1 54 THR n 1 55 ILE n 1 56 VAL n 1 57 GLY n 1 58 ASP n 1 59 GLY n 1 60 LYS n 1 61 TYR n 1 62 GLY n 1 63 ALA n 1 64 ARG n 1 65 ASP n 1 66 ALA n 1 67 ASP n 1 68 THR n 1 69 LYS n 1 70 ILE n 1 71 TRP n 1 72 ASN n 1 73 GLY n 1 74 MET n 1 75 VAL n 1 76 GLY n 1 77 GLU n 1 78 LEU n 1 79 VAL n 1 80 TYR n 1 81 GLY n 1 82 LYS n 1 83 ALA n 1 84 ASP n 1 85 ILE n 1 86 ALA n 1 87 ILE n 1 88 ALA n 1 89 PRO n 1 90 LEU n 1 91 THR n 1 92 ILE n 1 93 THR n 1 94 LEU n 1 95 VAL n 1 96 ARG n 1 97 GLU n 1 98 GLU n 1 99 VAL n 1 100 ILE n 1 101 ASP n 1 102 PHE n 1 103 SER n 1 104 LYS n 1 105 PRO n 1 106 PHE n 1 107 MET n 1 108 SER n 1 109 LEU n 1 110 GLY n 1 111 ILE n 1 112 SER n 1 113 ILE n 1 114 MET n 1 115 ILE n 1 116 LYS n 1 117 LYS n 1 118 GLY n 1 119 THR n 1 120 PRO n 1 121 ILE n 1 122 GLU n 1 123 SER n 1 124 ALA n 1 125 GLU n 1 126 ASP n 1 127 LEU n 1 128 SER n 1 129 LYS n 1 130 GLN n 1 131 THR n 1 132 GLU n 1 133 ILE n 1 134 ALA n 1 135 TYR n 1 136 GLY n 1 137 THR n 1 138 LEU n 1 139 ASP n 1 140 SER n 1 141 GLY n 1 142 SER n 1 143 THR n 1 144 LYS n 1 145 GLU n 1 146 PHE n 1 147 PHE n 1 148 ARG n 1 149 ARG n 1 150 SER n 1 151 LYS n 1 152 ILE n 1 153 ALA n 1 154 VAL n 1 155 PHE n 1 156 ASP n 1 157 LYS n 1 158 MET n 1 159 TRP n 1 160 THR n 1 161 TYR n 1 162 MET n 1 163 ARG n 1 164 SER n 1 165 ALA n 1 166 GLU n 1 167 PRO n 1 168 SER n 1 169 VAL n 1 170 PHE n 1 171 VAL n 1 172 ARG n 1 173 THR n 1 174 THR n 1 175 ALA n 1 176 GLU n 1 177 GLY n 1 178 VAL n 1 179 ALA n 1 180 ARG n 1 181 VAL n 1 182 ARG n 1 183 LYS n 1 184 SER n 1 185 LYS n 1 186 GLY n 1 187 LYS n 1 188 TYR n 1 189 ALA n 1 190 TYR n 1 191 LEU n 1 192 LEU n 1 193 GLU n 1 194 SER n 1 195 THR n 1 196 MET n 1 197 ASN n 1 198 GLU n 1 199 TYR n 1 200 ILE n 1 201 GLU n 1 202 GLN n 1 203 ARG n 1 204 LYS n 1 205 PRO n 1 206 CYS n 1 207 ASP n 1 208 THR n 1 209 MET n 1 210 LYS n 1 211 VAL n 1 212 GLY n 1 213 GLY n 1 214 ASN n 1 215 LEU n 1 216 ASP n 1 217 SER n 1 218 LYS n 1 219 GLY n 1 220 TYR n 1 221 GLY n 1 222 ILE n 1 223 ALA n 1 224 THR n 1 225 PRO n 1 226 LYS n 1 227 GLY n 1 228 SER n 1 229 SER n 1 230 LEU n 1 231 GLY n 1 232 ASN n 1 233 ALA n 1 234 VAL n 1 235 ASN n 1 236 LEU n 1 237 ALA n 1 238 VAL n 1 239 LEU n 1 240 LYS n 1 241 LEU n 1 242 ASN n 1 243 GLU n 1 244 GLN n 1 245 GLY n 1 246 LEU n 1 247 LEU n 1 248 ASP n 1 249 LYS n 1 250 LEU n 1 251 LYS n 1 252 ASN n 1 253 LYS n 1 254 TRP n 1 255 TRP n 1 256 TYR n 1 257 ASP n 1 258 LYS n 1 259 GLY n 1 260 GLU n 1 261 CYS n 1 262 GLY n 1 263 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? 3 117 'Norway rat' Rattus ? ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? BRAIN ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? VECTOR PET30B ? ? ? ? ? 1 2 sample ? 120 263 'Norway rat' Rattus ? ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? BRAIN ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? VECTOR PET30B ? ? ? ? ? # _struct_ref.id 1 _struct_ref.db_code GRIA2_RAT _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P19491 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1FW0 A 3 ? 117 ? P19491 413 ? 527 ? 3 117 2 1 1FW0 A 120 ? 263 ? P19491 653 ? 796 ? 120 263 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1FW0 GLY A 1 ? UNP P19491 ? ? 'Cloning Artifact' 1 1 1 1FW0 ALA A 2 ? UNP P19491 ? ? 'Cloning Artifact' 2 2 1 1FW0 GLY A 118 ? UNP P19491 ? ? Linker 118 3 1 1FW0 THR A 119 ? UNP P19491 ? ? Linker 119 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 KAI non-polymer . '3-(CARBOXYMETHYL)-4-ISOPROPENYLPROLINE' KAINATE 'C10 H15 N O4' 213.230 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1FW0 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 42.29 _exptl_crystal.density_Matthews 2.13 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.temp 274 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '10% PEG 1450, 0.1 M sodium acetate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 274K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 1999-11-20 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1FW0 _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 1.9 _reflns.number_obs 18725 _reflns.number_all 20382 _reflns.percent_possible_obs 92.0 _reflns.pdbx_Rmerge_I_obs 0.033 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 29.4 _reflns.B_iso_Wilson_estimate 20.76 _reflns.pdbx_redundancy 5.15 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.97 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 61.9 _reflns_shell.Rmerge_I_obs 0.137 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 3.90 _reflns_shell.number_unique_all 1230 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1FW0 _refine.ls_number_reflns_obs 16649 _refine.ls_number_reflns_all 16766 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 1.9 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.281 _refine.ls_R_factor_all 0.281 _refine.ls_R_factor_R_work 0.245 _refine.ls_R_factor_R_free 0.308 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 807 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details 'includes bulk solvent modeling' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1883 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 78 _refine_hist.number_atoms_total 1976 _refine_hist.d_res_high 1.9 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_angle_deg 1.7 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d 0.011 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1FW0 _struct.title 'CRYSTAL STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) IN COMPLEX WITH KAINATE AT 2.0 A RESOLUTION' _struct.pdbx_descriptor 'GLUR2 LIGAND BINDING CORE (S1S2J)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FW0 _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'Ionotropic Glutamate Receptor, GluR2, kainate, partial agonist, ligand binding domain, MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 21 ? LEU A 26 ? LYS A 21 LEU A 26 5 ? 6 HELX_P HELX_P2 2 GLU A 27 ? GLU A 30 ? GLU A 27 GLU A 30 5 ? 4 HELX_P HELX_P3 3 GLY A 34 ? GLY A 48 ? GLY A 34 GLY A 48 1 ? 15 HELX_P HELX_P4 4 ASN A 72 ? TYR A 80 ? ASN A 72 TYR A 80 1 ? 9 HELX_P HELX_P5 5 THR A 93 ? GLU A 98 ? THR A 93 GLU A 98 1 ? 6 HELX_P HELX_P6 6 SER A 123 ? LYS A 129 ? SER A 123 LYS A 129 1 ? 7 HELX_P HELX_P7 7 GLY A 141 ? ARG A 149 ? GLY A 141 ARG A 149 1 ? 9 HELX_P HELX_P8 8 ILE A 152 ? ALA A 165 ? ILE A 152 ALA A 165 1 ? 14 HELX_P HELX_P9 9 THR A 173 ? SER A 184 ? THR A 173 SER A 184 1 ? 12 HELX_P HELX_P10 10 SER A 194 ? GLU A 201 ? SER A 194 GLU A 201 1 ? 8 HELX_P HELX_P11 11 LEU A 230 ? GLN A 244 ? LEU A 230 GLN A 244 1 ? 15 HELX_P HELX_P12 12 GLY A 245 ? TYR A 256 ? GLY A 245 TYR A 256 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 206 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 261 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 206 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 261 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.156 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 14 A . ? SER 14 A PRO 15 A ? PRO 15 A 1 -0.54 2 LYS 204 A . ? LYS 204 A PRO 205 A ? PRO 205 A 1 0.26 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? C ? 2 ? D ? 2 ? E ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel E 1 2 ? parallel E 2 3 ? anti-parallel E 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 51 ? ILE A 55 ? TYR A 51 ILE A 55 A 2 VAL A 6 ? THR A 10 ? VAL A 6 THR A 10 A 3 ILE A 85 ? ALA A 86 ? ILE A 85 ALA A 86 B 1 MET A 18 ? MET A 19 ? MET A 18 MET A 19 B 2 TYR A 32 ? GLU A 33 ? TYR A 32 GLU A 33 C 1 ILE A 100 ? PHE A 102 ? ILE A 100 PHE A 102 C 2 ALA A 223 ? PRO A 225 ? ALA A 223 PRO A 225 D 1 MET A 107 ? LEU A 109 ? MET A 107 LEU A 109 D 2 LYS A 218 ? TYR A 220 ? LYS A 218 TYR A 220 E 1 ALA A 134 ? GLY A 136 ? ALA A 134 GLY A 136 E 2 TYR A 188 ? GLU A 193 ? TYR A 188 GLU A 193 E 3 ILE A 111 ? LYS A 116 ? ILE A 111 LYS A 116 E 4 THR A 208 ? VAL A 211 ? THR A 208 VAL A 211 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 52 ? N LYS A 52 O VAL A 6 ? O VAL A 6 A 2 3 N THR A 9 ? N THR A 9 O ILE A 85 ? O ILE A 85 B 1 2 O MET A 18 ? O MET A 18 N GLU A 33 ? N GLU A 33 C 1 2 N ASP A 101 ? N ASP A 101 O THR A 224 ? O THR A 224 D 1 2 O LEU A 109 ? O LEU A 109 N LYS A 218 ? N LYS A 218 E 1 2 O ALA A 134 ? O ALA A 134 N ALA A 189 ? N ALA A 189 E 2 3 O LEU A 192 ? O LEU A 192 N SER A 112 ? N SER A 112 E 3 4 N ILE A 115 ? N ILE A 115 O MET A 209 ? O MET A 209 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'BINDING SITE FOR RESIDUE KAI A 999' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 GLU A 13 ? GLU A 13 . ? 1_555 ? 2 AC1 13 TYR A 61 ? TYR A 61 . ? 1_555 ? 3 AC1 13 PRO A 89 ? PRO A 89 . ? 1_555 ? 4 AC1 13 LEU A 90 ? LEU A 90 . ? 1_555 ? 5 AC1 13 THR A 91 ? THR A 91 . ? 1_555 ? 6 AC1 13 ARG A 96 ? ARG A 96 . ? 1_555 ? 7 AC1 13 GLY A 141 ? GLY A 141 . ? 1_555 ? 8 AC1 13 SER A 142 ? SER A 142 . ? 1_555 ? 9 AC1 13 THR A 143 ? THR A 143 . ? 1_555 ? 10 AC1 13 GLU A 193 ? GLU A 193 . ? 1_555 ? 11 AC1 13 MET A 196 ? MET A 196 . ? 1_555 ? 12 AC1 13 HOH C . ? HOH A 1001 . ? 1_555 ? 13 AC1 13 HOH C . ? HOH A 1051 . ? 1_555 ? # _database_PDB_matrix.entry_id 1FW0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FW0 _atom_sites.fract_transf_matrix[1][1] 0.017458 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011234 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020461 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 GLN 130 130 130 GLN GLN A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 MET 158 158 158 MET MET A . n A 1 159 TRP 159 159 159 TRP TRP A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 MET 162 162 162 MET MET A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 TYR 188 188 188 TYR TYR A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 TYR 190 190 190 TYR TYR A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 MET 196 196 196 MET MET A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 CYS 206 206 206 CYS CYS A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 MET 209 209 209 MET MET A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 ASN 214 214 214 ASN ASN A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 LYS 218 218 218 LYS LYS A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 TYR 220 220 220 TYR TYR A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 PRO 225 225 225 PRO PRO A . n A 1 226 LYS 226 226 226 LYS LYS A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 SER 228 228 228 SER SER A . n A 1 229 SER 229 229 229 SER SER A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 ASN 232 232 232 ASN ASN A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 ASN 235 235 235 ASN ASN A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 VAL 238 238 238 VAL VAL A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 ASN 242 242 242 ASN ASN A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 GLN 244 244 244 GLN GLN A . n A 1 245 GLY 245 245 245 GLY GLY A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 ASP 248 248 248 ASP ASP A . n A 1 249 LYS 249 249 249 LYS LYS A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 LYS 251 251 251 LYS LYS A . n A 1 252 ASN 252 252 252 ASN ASN A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 TRP 254 254 254 TRP TRP A . n A 1 255 TRP 255 255 255 TRP TRP A . n A 1 256 TYR 256 256 256 TYR TYR A . n A 1 257 ASP 257 257 257 ASP ASP A . n A 1 258 LYS 258 258 258 LYS LYS A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 GLU 260 260 260 GLU GLU A . n A 1 261 CYS 261 261 261 CYS CYS A . n A 1 262 GLY 262 262 ? ? ? A . n A 1 263 SER 263 263 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 KAI 1 999 999 KAI KAI A . C 3 HOH 1 1000 1 HOH TIP A . C 3 HOH 2 1001 2 HOH TIP A . C 3 HOH 3 1002 3 HOH TIP A . C 3 HOH 4 1003 4 HOH TIP A . C 3 HOH 5 1004 5 HOH TIP A . C 3 HOH 6 1005 6 HOH TIP A . C 3 HOH 7 1006 7 HOH TIP A . C 3 HOH 8 1007 8 HOH TIP A . C 3 HOH 9 1008 9 HOH TIP A . C 3 HOH 10 1009 10 HOH TIP A . C 3 HOH 11 1010 11 HOH TIP A . C 3 HOH 12 1011 12 HOH TIP A . C 3 HOH 13 1012 13 HOH TIP A . C 3 HOH 14 1013 14 HOH TIP A . C 3 HOH 15 1014 15 HOH TIP A . C 3 HOH 16 1015 16 HOH TIP A . C 3 HOH 17 1016 17 HOH TIP A . C 3 HOH 18 1017 18 HOH TIP A . C 3 HOH 19 1018 19 HOH TIP A . C 3 HOH 20 1019 20 HOH TIP A . C 3 HOH 21 1020 21 HOH TIP A . C 3 HOH 22 1021 22 HOH TIP A . C 3 HOH 23 1022 23 HOH TIP A . C 3 HOH 24 1023 24 HOH TIP A . C 3 HOH 25 1024 25 HOH TIP A . C 3 HOH 26 1025 26 HOH TIP A . C 3 HOH 27 1026 27 HOH TIP A . C 3 HOH 28 1027 28 HOH TIP A . C 3 HOH 29 1028 29 HOH TIP A . C 3 HOH 30 1029 30 HOH TIP A . C 3 HOH 31 1030 31 HOH TIP A . C 3 HOH 32 1031 32 HOH TIP A . C 3 HOH 33 1032 33 HOH TIP A . C 3 HOH 34 1033 34 HOH TIP A . C 3 HOH 35 1034 35 HOH TIP A . C 3 HOH 36 1035 36 HOH TIP A . C 3 HOH 37 1036 37 HOH TIP A . C 3 HOH 38 1037 38 HOH TIP A . C 3 HOH 39 1038 39 HOH TIP A . C 3 HOH 40 1039 40 HOH TIP A . C 3 HOH 41 1040 41 HOH TIP A . C 3 HOH 42 1041 43 HOH TIP A . C 3 HOH 43 1042 44 HOH TIP A . C 3 HOH 44 1043 45 HOH TIP A . C 3 HOH 45 1044 46 HOH TIP A . C 3 HOH 46 1045 47 HOH TIP A . C 3 HOH 47 1046 48 HOH TIP A . C 3 HOH 48 1047 49 HOH TIP A . C 3 HOH 49 1048 50 HOH TIP A . C 3 HOH 50 1049 51 HOH TIP A . C 3 HOH 51 1050 52 HOH TIP A . C 3 HOH 52 1051 53 HOH TIP A . C 3 HOH 53 1052 55 HOH TIP A . C 3 HOH 54 1053 57 HOH TIP A . C 3 HOH 55 1054 60 HOH TIP A . C 3 HOH 56 1055 62 HOH TIP A . C 3 HOH 57 1056 63 HOH TIP A . C 3 HOH 58 1057 64 HOH TIP A . C 3 HOH 59 1058 65 HOH TIP A . C 3 HOH 60 1059 67 HOH TIP A . C 3 HOH 61 1060 69 HOH TIP A . C 3 HOH 62 1061 70 HOH TIP A . C 3 HOH 63 1062 73 HOH TIP A . C 3 HOH 64 1063 74 HOH TIP A . C 3 HOH 65 1064 75 HOH TIP A . C 3 HOH 66 1065 76 HOH TIP A . C 3 HOH 67 1066 77 HOH TIP A . C 3 HOH 68 1067 78 HOH TIP A . C 3 HOH 69 1068 79 HOH TIP A . C 3 HOH 70 1069 80 HOH TIP A . C 3 HOH 71 1070 81 HOH TIP A . C 3 HOH 72 1071 82 HOH TIP A . C 3 HOH 73 1072 83 HOH TIP A . C 3 HOH 74 1073 84 HOH TIP A . C 3 HOH 75 1074 85 HOH TIP A . C 3 HOH 76 1075 86 HOH TIP A . C 3 HOH 77 1076 87 HOH TIP A . C 3 HOH 78 1077 88 HOH TIP A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-11-15 2 'Structure model' 1 1 2008-04-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 4 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_src_gen 2 4 'Structure model' software # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 AMoRE phasing . ? 3 X-PLOR refinement 3.851 ? 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 THR _pdbx_validate_rmsd_angle.auth_seq_id_1 119 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 120 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 120 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 128.86 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 9.56 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 13 ? ? -170.78 124.00 2 1 TYR A 61 ? ? -95.41 -65.73 3 1 LYS A 69 ? ? 58.87 17.77 4 1 PRO A 120 ? ? -59.94 6.26 5 1 THR A 131 ? ? -149.23 -12.26 6 1 ARG A 149 ? ? -71.64 37.62 7 1 LYS A 151 ? ? -148.10 34.01 8 1 ALA A 153 ? ? -20.65 -71.29 9 1 ALA A 165 ? ? -38.79 145.55 10 1 GLU A 166 ? ? -60.60 -94.35 11 1 CYS A 206 ? ? 71.42 33.85 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 4 ? CB ? A LYS 4 CB 2 1 Y 1 A LYS 4 ? CG ? A LYS 4 CG 3 1 Y 1 A LYS 4 ? CD ? A LYS 4 CD 4 1 Y 1 A LYS 4 ? CE ? A LYS 4 CE 5 1 Y 1 A LYS 4 ? NZ ? A LYS 4 NZ 6 1 Y 1 A LYS 21 ? CB ? A LYS 21 CB 7 1 Y 1 A LYS 21 ? CG ? A LYS 21 CG 8 1 Y 1 A LYS 21 ? CD ? A LYS 21 CD 9 1 Y 1 A LYS 21 ? CE ? A LYS 21 CE 10 1 Y 1 A LYS 21 ? NZ ? A LYS 21 NZ 11 1 Y 1 A ASN 22 ? CG ? A ASN 22 CG 12 1 Y 1 A ASN 22 ? OD1 ? A ASN 22 OD1 13 1 Y 1 A ASN 22 ? ND2 ? A ASN 22 ND2 14 1 Y 1 A GLU 24 ? CB ? A GLU 24 CB 15 1 Y 1 A GLU 24 ? CG ? A GLU 24 CG 16 1 Y 1 A GLU 24 ? CD ? A GLU 24 CD 17 1 Y 1 A GLU 24 ? OE1 ? A GLU 24 OE1 18 1 Y 1 A GLU 24 ? OE2 ? A GLU 24 OE2 19 1 Y 1 A GLU 27 ? CB ? A GLU 27 CB 20 1 Y 1 A GLU 27 ? CG ? A GLU 27 CG 21 1 Y 1 A GLU 27 ? CD ? A GLU 27 CD 22 1 Y 1 A GLU 27 ? OE1 ? A GLU 27 OE1 23 1 Y 1 A GLU 27 ? OE2 ? A GLU 27 OE2 24 1 Y 1 A GLU 30 ? CB ? A GLU 30 CB 25 1 Y 1 A GLU 30 ? CG ? A GLU 30 CG 26 1 Y 1 A GLU 30 ? CD ? A GLU 30 CD 27 1 Y 1 A GLU 30 ? OE1 ? A GLU 30 OE1 28 1 Y 1 A GLU 30 ? OE2 ? A GLU 30 OE2 29 1 Y 1 A LYS 50 ? CG ? A LYS 50 CG 30 1 Y 1 A LYS 50 ? CD ? A LYS 50 CD 31 1 Y 1 A LYS 50 ? CE ? A LYS 50 CE 32 1 Y 1 A LYS 50 ? NZ ? A LYS 50 NZ 33 1 Y 1 A LYS 52 ? CG ? A LYS 52 CG 34 1 Y 1 A LYS 52 ? CD ? A LYS 52 CD 35 1 Y 1 A LYS 52 ? CE ? A LYS 52 CE 36 1 Y 1 A LYS 52 ? NZ ? A LYS 52 NZ 37 1 Y 1 A ASP 65 ? CG ? A ASP 65 CG 38 1 Y 1 A ASP 65 ? OD1 ? A ASP 65 OD1 39 1 Y 1 A ASP 65 ? OD2 ? A ASP 65 OD2 40 1 Y 1 A ASP 67 ? CB ? A ASP 67 CB 41 1 Y 1 A ASP 67 ? CG ? A ASP 67 CG 42 1 Y 1 A ASP 67 ? OD1 ? A ASP 67 OD1 43 1 Y 1 A ASP 67 ? OD2 ? A ASP 67 OD2 44 1 Y 1 A LYS 82 ? CG ? A LYS 82 CG 45 1 Y 1 A LYS 82 ? CD ? A LYS 82 CD 46 1 Y 1 A LYS 82 ? CE ? A LYS 82 CE 47 1 Y 1 A LYS 82 ? NZ ? A LYS 82 NZ 48 1 Y 1 A GLU 122 ? CB ? A GLU 122 CB 49 1 Y 1 A GLU 122 ? CG ? A GLU 122 CG 50 1 Y 1 A GLU 122 ? CD ? A GLU 122 CD 51 1 Y 1 A GLU 122 ? OE1 ? A GLU 122 OE1 52 1 Y 1 A GLU 122 ? OE2 ? A GLU 122 OE2 53 1 Y 1 A GLU 125 ? CB ? A GLU 125 CB 54 1 Y 1 A GLU 125 ? CG ? A GLU 125 CG 55 1 Y 1 A GLU 125 ? CD ? A GLU 125 CD 56 1 Y 1 A GLU 125 ? OE1 ? A GLU 125 OE1 57 1 Y 1 A GLU 125 ? OE2 ? A GLU 125 OE2 58 1 Y 1 A THR 131 ? CB ? A THR 131 CB 59 1 Y 1 A THR 131 ? OG1 ? A THR 131 OG1 60 1 Y 1 A THR 131 ? CG2 ? A THR 131 CG2 61 1 Y 1 A GLU 132 ? CB ? A GLU 132 CB 62 1 Y 1 A GLU 132 ? CG ? A GLU 132 CG 63 1 Y 1 A GLU 132 ? CD ? A GLU 132 CD 64 1 Y 1 A GLU 132 ? OE1 ? A GLU 132 OE1 65 1 Y 1 A GLU 132 ? OE2 ? A GLU 132 OE2 66 1 Y 1 A ILE 133 ? CB ? A ILE 133 CB 67 1 Y 1 A ILE 133 ? CG1 ? A ILE 133 CG1 68 1 Y 1 A ILE 133 ? CG2 ? A ILE 133 CG2 69 1 Y 1 A ILE 133 ? CD1 ? A ILE 133 CD1 70 1 Y 1 A ARG 149 ? CG ? A ARG 149 CG 71 1 Y 1 A ARG 149 ? CD ? A ARG 149 CD 72 1 Y 1 A ARG 149 ? NE ? A ARG 149 NE 73 1 Y 1 A ARG 149 ? CZ ? A ARG 149 CZ 74 1 Y 1 A ARG 149 ? NH1 ? A ARG 149 NH1 75 1 Y 1 A ARG 149 ? NH2 ? A ARG 149 NH2 76 1 Y 1 A LYS 151 ? CG ? A LYS 151 CG 77 1 Y 1 A LYS 151 ? CD ? A LYS 151 CD 78 1 Y 1 A LYS 151 ? CE ? A LYS 151 CE 79 1 Y 1 A LYS 151 ? NZ ? A LYS 151 NZ 80 1 Y 1 A ILE 152 ? CB ? A ILE 152 CB 81 1 Y 1 A ILE 152 ? CG1 ? A ILE 152 CG1 82 1 Y 1 A ILE 152 ? CG2 ? A ILE 152 CG2 83 1 Y 1 A ILE 152 ? CD1 ? A ILE 152 CD1 84 1 Y 1 A ALA 153 ? CB ? A ALA 153 CB 85 1 Y 1 A ASP 156 ? CB ? A ASP 156 CB 86 1 Y 1 A ASP 156 ? CG ? A ASP 156 CG 87 1 Y 1 A ASP 156 ? OD1 ? A ASP 156 OD1 88 1 Y 1 A ASP 156 ? OD2 ? A ASP 156 OD2 89 1 Y 1 A ARG 163 ? CG ? A ARG 163 CG 90 1 Y 1 A ARG 163 ? CD ? A ARG 163 CD 91 1 Y 1 A ARG 163 ? NE ? A ARG 163 NE 92 1 Y 1 A ARG 163 ? CZ ? A ARG 163 CZ 93 1 Y 1 A ARG 163 ? NH1 ? A ARG 163 NH1 94 1 Y 1 A ARG 163 ? NH2 ? A ARG 163 NH2 95 1 Y 1 A SER 164 ? CB ? A SER 164 CB 96 1 Y 1 A SER 164 ? OG ? A SER 164 OG 97 1 Y 1 A GLU 166 ? CB ? A GLU 166 CB 98 1 Y 1 A GLU 166 ? CG ? A GLU 166 CG 99 1 Y 1 A GLU 166 ? CD ? A GLU 166 CD 100 1 Y 1 A GLU 166 ? OE1 ? A GLU 166 OE1 101 1 Y 1 A GLU 166 ? OE2 ? A GLU 166 OE2 102 1 Y 1 A SER 168 ? CB ? A SER 168 CB 103 1 Y 1 A SER 168 ? OG ? A SER 168 OG 104 1 Y 1 A ARG 172 ? CG ? A ARG 172 CG 105 1 Y 1 A ARG 172 ? CD ? A ARG 172 CD 106 1 Y 1 A ARG 172 ? NE ? A ARG 172 NE 107 1 Y 1 A ARG 172 ? CZ ? A ARG 172 CZ 108 1 Y 1 A ARG 172 ? NH1 ? A ARG 172 NH1 109 1 Y 1 A ARG 172 ? NH2 ? A ARG 172 NH2 110 1 Y 1 A LYS 183 ? CG ? A LYS 183 CG 111 1 Y 1 A LYS 183 ? CD ? A LYS 183 CD 112 1 Y 1 A LYS 183 ? CE ? A LYS 183 CE 113 1 Y 1 A LYS 183 ? NZ ? A LYS 183 NZ 114 1 Y 1 A SER 184 ? CB ? A SER 184 CB 115 1 Y 1 A SER 184 ? OG ? A SER 184 OG 116 1 Y 1 A LYS 185 ? CB ? A LYS 185 CB 117 1 Y 1 A LYS 185 ? CG ? A LYS 185 CG 118 1 Y 1 A LYS 185 ? CD ? A LYS 185 CD 119 1 Y 1 A LYS 185 ? CE ? A LYS 185 CE 120 1 Y 1 A LYS 185 ? NZ ? A LYS 185 NZ 121 1 Y 1 A LYS 187 ? CB ? A LYS 187 CB 122 1 Y 1 A LYS 187 ? CG ? A LYS 187 CG 123 1 Y 1 A LYS 187 ? CD ? A LYS 187 CD 124 1 Y 1 A LYS 187 ? CE ? A LYS 187 CE 125 1 Y 1 A LYS 187 ? NZ ? A LYS 187 NZ 126 1 Y 1 A LYS 226 ? CG ? A LYS 226 CG 127 1 Y 1 A LYS 226 ? CD ? A LYS 226 CD 128 1 Y 1 A LYS 226 ? CE ? A LYS 226 CE 129 1 Y 1 A LYS 226 ? NZ ? A LYS 226 NZ 130 1 Y 1 A LYS 258 ? CB ? A LYS 258 CB 131 1 Y 1 A LYS 258 ? CG ? A LYS 258 CG 132 1 Y 1 A LYS 258 ? CD ? A LYS 258 CD 133 1 Y 1 A LYS 258 ? CE ? A LYS 258 CE 134 1 Y 1 A LYS 258 ? NZ ? A LYS 258 NZ 135 1 Y 1 A CYS 261 ? O ? A CYS 261 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A GLY 262 ? A GLY 262 5 1 Y 1 A SER 263 ? A SER 263 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-(CARBOXYMETHYL)-4-ISOPROPENYLPROLINE' KAI 3 water HOH #