data_1G26 # _entry.id 1G26 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1G26 pdb_00001g26 10.2210/pdb1g26/pdb RCSB RCSB012140 ? ? WWPDB D_1000012140 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1QGM '1QGM belongs to a family of granulin-like repeats' unspecified PDB 1FWO '1FWO belongs to a family of granulin-like repeats' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1G26 _pdbx_database_status.recvd_initial_deposition_date 2000-10-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tolkatchev, D.' 1 'Ng, A.' 2 'Vranken, W.' 3 'Ni, F.' 4 # _citation.id primary _citation.title 'Design and solution structure of a well-folded stack of two beta-hairpins based on the amino-terminal fragment of human granulin A.' _citation.journal_abbrev Biochemistry _citation.journal_volume 39 _citation.page_first 2878 _citation.page_last 2886 _citation.year 2000 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10715107 _citation.pdbx_database_id_DOI 10.1021/bi992130u # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tolkatchev, D.' 1 ? primary 'Ng, A.' 2 ? primary 'Vranken, W.' 3 ? primary 'Ni, F.' 4 ? # _cell.entry_id 1G26 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1G26 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'GRANULIN A' _entity.formula_weight 3393.955 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'D1V, K3H, S9I, Q20P' _entity.pdbx_fragment 'N-TERMINAL DOMAIN (RESIDUES 1-31)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name HGA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VVHCDMEVICPDGYTCCRLPSGAWGCCPFTQ _entity_poly.pdbx_seq_one_letter_code_can VVHCDMEVICPDGYTCCRLPSGAWGCCPFTQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 HIS n 1 4 CYS n 1 5 ASP n 1 6 MET n 1 7 GLU n 1 8 VAL n 1 9 ILE n 1 10 CYS n 1 11 PRO n 1 12 ASP n 1 13 GLY n 1 14 TYR n 1 15 THR n 1 16 CYS n 1 17 CYS n 1 18 ARG n 1 19 LEU n 1 20 PRO n 1 21 SER n 1 22 GLY n 1 23 ALA n 1 24 TRP n 1 25 GLY n 1 26 CYS n 1 27 CYS n 1 28 PRO n 1 29 PHE n 1 30 THR n 1 31 GLN n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;The peptide was chemically synthesized using standard Fmoc chemistry and oxidized by air in solution, Cys17 and Cys27 were blocked with S-acetamidomethyl groups (Acm) ; # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GRN_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGT SSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCED RVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCC SDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIH CCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDH QHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGGTCCPSLGGSWACCQLPHAVCCEDRQH CCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCP AGFRCAARGTKCLRREAPRWDAPLRDPALRQLL ; _struct_ref.pdbx_align_begin 281 _struct_ref.pdbx_db_accession P28799 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1G26 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P28799 _struct_ref_seq.db_align_beg 281 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 311 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1G26 VAL A 1 ? UNP P28799 ASP 281 'engineered mutation' 1 1 1 1G26 HIS A 3 ? UNP P28799 LYS 283 'engineered mutation' 3 2 1 1G26 ILE A 9 ? UNP P28799 SER 289 'engineered mutation' 9 3 1 1G26 PRO A 20 ? UNP P28799 GLN 300 'engineered mutation' 20 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 2 '2D NOESY' 3 2 1 '2D NOESY' 4 2 2 '2D NOESY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 288 ambient 5.0 ? ? K 2 298 ambient 5.0 ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.5 mM HGA 1-31 (D1V, K3H, S9I, Q20P); 20 mM sodium acetate-d3, 10% D2O, 90% H2O' '10% D2O, 90% H2O' 2 '0.5 mM HGA 1-31 (D1V, K3H, S9I, Q20P); 20 mM sodium acetate-d3, 100% D2O' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 500 2 ? Bruker DRX 500 # _pdbx_nmr_refine.entry_id 1G26 _pdbx_nmr_refine.method 'distance geometry and simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 241 restraints, 174 are unambiguous NOE-derived distance constraints, 47 ambiguous NOE-derived distance constraints, 8 dihedral angle restraints, 10 distance restraints from hydrogen bonds, 2 distance restraints from disulfide bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1G26 _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques' # _pdbx_nmr_ensemble.entry_id 1G26 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.1 refinement Brunger 1 X-PLOR 3.1 'structure solution' Brunger 2 # _exptl.entry_id 1G26 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1G26 _struct.title 'THE SOLUTION STRUCTURE OF A WELL-FOLDED PEPTIDE BASED ON THE 31-RESIDUE AMINO-TERMINAL SUBDOMAIN OF HUMAN GRANULIN A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1G26 _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text 'granulin/epithelin protein repeats, beta-hairpin stack, CYTOKINE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 4 A CYS 16 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 10 A CYS 26 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 2 ? ASP A 5 ? VAL A 2 ASP A 5 A 2 VAL A 8 ? CYS A 10 ? VAL A 8 CYS A 10 B 1 TYR A 14 ? ARG A 18 ? TYR A 14 ARG A 18 B 2 TRP A 24 ? PRO A 28 ? TRP A 24 PRO A 28 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 5 ? N ASP A 5 O VAL A 8 ? O VAL A 8 B 1 2 O CYS A 17 ? O CYS A 17 N GLY A 25 ? N GLY A 25 # _database_PDB_matrix.entry_id 1G26 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1G26 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 GLN 31 31 31 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-11-01 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PRO 11 ? ? H A TYR 14 ? ? 1.56 2 3 O A PRO 11 ? ? H A GLY 13 ? ? 1.56 3 5 O A PRO 11 ? ? H A GLY 13 ? ? 1.55 4 6 O A PRO 11 ? ? H A GLY 13 ? ? 1.55 5 8 H A VAL 2 ? ? O A CYS 10 ? ? 1.59 6 10 O A PRO 11 ? ? H A GLY 13 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 3 ? ? -51.59 89.77 2 1 ASP A 5 ? ? 177.90 -170.79 3 2 VAL A 8 ? ? -167.19 119.62 4 2 ASP A 12 ? ? 54.12 -77.57 5 3 HIS A 3 ? ? -46.05 106.67 6 3 ASP A 5 ? ? -156.87 -139.71 7 3 PRO A 11 ? ? -81.15 41.06 8 3 ASP A 12 ? ? 66.34 -57.97 9 3 PHE A 29 ? ? -147.63 59.84 10 3 THR A 30 ? ? -116.18 69.92 11 4 ASP A 5 ? ? -168.88 -166.45 12 4 SER A 21 ? ? -99.14 31.66 13 5 HIS A 3 ? ? -59.07 82.32 14 5 GLU A 7 ? ? -136.61 -33.16 15 5 PRO A 11 ? ? -80.33 38.01 16 5 ASP A 12 ? ? 66.32 -56.33 17 5 PHE A 29 ? ? -147.66 -45.42 18 6 ASP A 5 ? ? -169.54 -80.08 19 6 MET A 6 ? ? -146.15 -53.79 20 6 PRO A 11 ? ? -78.59 43.14 21 6 ASP A 12 ? ? 65.05 -58.95 22 7 HIS A 3 ? ? 56.07 93.50 23 7 ASP A 5 ? ? -163.40 -153.61 24 7 PRO A 11 ? ? -80.25 38.84 25 7 ASP A 12 ? ? 66.69 138.19 26 7 PHE A 29 ? ? -153.60 20.56 27 8 ASP A 5 ? ? -145.46 -147.27 28 8 ASP A 12 ? ? -48.86 -19.16 29 8 PRO A 20 ? ? -80.01 41.58 30 8 SER A 21 ? ? -168.33 30.05 31 8 THR A 30 ? ? -143.26 37.65 32 9 ASP A 5 ? ? -160.18 -134.10 33 9 GLU A 7 ? ? -121.83 -60.92 34 9 PRO A 11 ? ? -78.98 42.77 35 9 ASP A 12 ? ? 63.04 137.91 36 9 PHE A 29 ? ? -158.53 53.74 37 10 VAL A 2 ? ? -104.40 56.07 38 10 ASP A 5 ? ? -146.54 -60.61 39 10 MET A 6 ? ? -176.51 -36.03 40 10 PRO A 11 ? ? -82.09 32.98 41 10 ASP A 12 ? ? 66.59 -56.31 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 18 ? ? 0.275 'SIDE CHAIN' 2 2 ARG A 18 ? ? 0.205 'SIDE CHAIN' 3 3 ARG A 18 ? ? 0.181 'SIDE CHAIN' 4 4 ARG A 18 ? ? 0.317 'SIDE CHAIN' 5 5 ARG A 18 ? ? 0.285 'SIDE CHAIN' 6 6 ARG A 18 ? ? 0.260 'SIDE CHAIN' 7 7 ARG A 18 ? ? 0.180 'SIDE CHAIN' 8 8 ARG A 18 ? ? 0.235 'SIDE CHAIN' 9 9 ARG A 18 ? ? 0.262 'SIDE CHAIN' 10 10 ARG A 18 ? ? 0.282 'SIDE CHAIN' #