data_1GPS # _entry.id 1GPS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1GPS WWPDB D_1000173663 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1GPS _pdbx_database_status.recvd_initial_deposition_date 1992-07-29 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bruix, M.' 1 'Jimenez, M.A.' 2 'Santoro, J.' 3 'Gonzalez, C.' 4 'Colilla, F.J.' 5 'Mendez, E.' 6 'Rico, M.' 7 # _citation.id primary _citation.title ;Solution structure of gamma 1-H and gamma 1-P thionins from barley and wheat endosperm determined by 1H-NMR: a structural motif common to toxic arthropod proteins. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 32 _citation.page_first 715 _citation.page_last 724 _citation.year 1993 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 8380707 _citation.pdbx_database_id_DOI 10.1021/bi00053a041 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bruix, M.' 1 primary 'Jimenez, M.A.' 2 primary 'Santoro, J.' 3 primary 'Gonzalez, C.' 4 primary 'Colilla, F.J.' 5 primary 'Mendez, E.' 6 primary 'Rico, M.' 7 # _cell.entry_id 1GPS _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1GPS _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'GAMMA-1-P THIONIN' _entity.formula_weight 5249.167 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KICRRRSAGFKGPCMSNKNCAQVCQQEGWGGGNCDGPFRRCKCIRQC _entity_poly.pdbx_seq_one_letter_code_can KICRRRSAGFKGPCMSNKNCAQVCQQEGWGGGNCDGPFRRCKCIRQC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 ILE n 1 3 CYS n 1 4 ARG n 1 5 ARG n 1 6 ARG n 1 7 SER n 1 8 ALA n 1 9 GLY n 1 10 PHE n 1 11 LYS n 1 12 GLY n 1 13 PRO n 1 14 CYS n 1 15 MET n 1 16 SER n 1 17 ASN n 1 18 LYS n 1 19 ASN n 1 20 CYS n 1 21 ALA n 1 22 GLN n 1 23 VAL n 1 24 CYS n 1 25 GLN n 1 26 GLN n 1 27 GLU n 1 28 GLY n 1 29 TRP n 1 30 GLY n 1 31 GLY n 1 32 GLY n 1 33 ASN n 1 34 CYS n 1 35 ASP n 1 36 GLY n 1 37 PRO n 1 38 PHE n 1 39 ARG n 1 40 ARG n 1 41 CYS n 1 42 LYS n 1 43 CYS n 1 44 ILE n 1 45 ARG n 1 46 GLN n 1 47 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Triticum _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Triticum turgidum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4571 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THG1_WHEAT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P20158 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code KICRRRSAGFKGPCMSNKNCAQVCQQEGWGGGNCDGPFRRCKCIRQC _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1GPS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 47 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P20158 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 47 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 47 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1GPS _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 8 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1GPS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1GPS _struct.title ;SOLUTION STRUCTURE OF GAMMA 1-H AND GAMMA 1-P THIONINS FROM BARLEY AND WHEAT ENDOSPERM DETERMINED BY 1H-NMR: A STRUCTURAL MOTIF COMMON TO TOXIC ARTHROPOD PROTEINS ; _struct.pdbx_descriptor 'GAMMA-1-P THIONIN (NMR, 8 STRUCTURES)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1GPS _struct_keywords.pdbx_keywords 'PLANT TOXIN' _struct_keywords.text 'PLANT TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id H1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 16 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 28 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 16 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 28 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 3 A CYS 47 1_555 ? ? ? ? ? ? ? 2.040 ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 14 A CYS 34 1_555 ? ? ? ? ? ? ? 2.035 ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 20 A CYS 41 1_555 ? ? ? ? ? ? ? 2.039 ? disulf4 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 24 A CYS 43 1_555 ? ? ? ? ? ? ? 2.035 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 LYS A 1 ? ARG A 6 ? LYS A 1 ARG A 6 S1 2 ARG A 39 ? CYS A 47 ? ARG A 39 CYS A 47 S1 3 GLY A 31 ? CYS A 34 ? GLY A 31 CYS A 34 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 O ARG A 5 ? O ARG A 5 N CYS A 43 ? N CYS A 43 S1 2 3 N ILE A 44 ? N ILE A 44 O GLY A 31 ? O GLY A 31 # _database_PDB_matrix.entry_id 1GPS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1GPS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 CYS 47 47 47 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1993-10-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 27 ? ? OE2 A GLU 27 ? ? 1.318 1.252 0.066 0.011 N 2 2 CD A GLU 27 ? ? OE2 A GLU 27 ? ? 1.318 1.252 0.066 0.011 N 3 8 CD A GLU 27 ? ? OE2 A GLU 27 ? ? 1.320 1.252 0.068 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.36 120.30 4.06 0.50 N 2 1 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 123.61 120.30 3.31 0.50 N 3 2 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.36 120.30 3.06 0.50 N 4 2 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH1 A ARG 40 ? ? 123.85 120.30 3.55 0.50 N 5 2 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH2 A ARG 40 ? ? 117.26 120.30 -3.04 0.50 N 6 3 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH2 A ARG 6 ? ? 115.13 120.30 -5.17 0.50 N 7 4 NE A ARG 4 ? ? CZ A ARG 4 ? ? NH2 A ARG 4 ? ? 116.06 120.30 -4.24 0.50 N 8 5 CD A LYS 1 ? ? CE A LYS 1 ? ? NZ A LYS 1 ? ? 95.42 111.70 -16.28 2.30 N 9 6 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 123.32 120.30 3.02 0.50 N 10 6 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH2 A ARG 45 ? ? 117.20 120.30 -3.10 0.50 N 11 7 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.48 120.30 3.18 0.50 N 12 7 CG A ARG 6 ? ? CD A ARG 6 ? ? NE A ARG 6 ? ? 95.56 111.80 -16.24 2.10 N 13 7 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH2 A ARG 6 ? ? 116.06 120.30 -4.24 0.50 N 14 7 CB A PHE 38 ? ? CG A PHE 38 ? ? CD2 A PHE 38 ? ? 116.08 120.80 -4.72 0.70 N 15 7 CA A LYS 42 ? ? CB A LYS 42 ? ? CG A LYS 42 ? ? 99.39 113.40 -14.01 2.20 N 16 8 NE A ARG 4 ? ? CZ A ARG 4 ? ? NH1 A ARG 4 ? ? 123.35 120.30 3.05 0.50 N 17 8 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.50 120.30 3.20 0.50 N 18 8 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.38 120.30 3.08 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 4 ? ? -118.85 73.70 2 1 SER A 7 ? ? -53.90 101.04 3 1 MET A 15 ? ? 64.63 -33.88 4 1 PRO A 37 ? ? -76.63 35.36 5 1 ARG A 39 ? ? -96.48 -62.95 6 2 ALA A 8 ? ? -81.98 30.99 7 2 CYS A 14 ? ? -107.05 78.91 8 2 PHE A 38 ? ? -82.10 44.87 9 3 ARG A 6 ? ? -45.34 150.09 10 3 ALA A 8 ? ? -68.42 39.15 11 3 PRO A 13 ? ? -56.79 100.61 12 3 SER A 16 ? ? -93.16 42.69 13 3 ASN A 17 ? ? -9.03 -58.75 14 3 ASN A 33 ? ? -145.08 -140.43 15 4 SER A 7 ? ? -50.18 102.83 16 4 PHE A 38 ? ? -74.34 37.31 17 5 ARG A 5 ? ? -139.07 -152.95 18 5 SER A 7 ? ? -62.49 6.23 19 5 ALA A 8 ? ? 54.37 -74.77 20 5 PHE A 38 ? ? -79.61 46.97 21 6 ALA A 8 ? ? 70.30 -47.13 22 6 PHE A 38 ? ? 69.39 -22.27 23 6 ARG A 39 ? ? -76.85 27.29 24 7 PHE A 10 ? ? -99.16 59.53 25 7 PRO A 13 ? ? -53.90 99.54 26 7 PHE A 38 ? ? -78.65 44.16 27 8 ARG A 4 ? ? -103.97 58.95 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 CYS A 3 ? ? 11.20 2 2 CYS A 3 ? ? 10.54 3 2 PRO A 13 ? ? -11.02 4 4 TRP A 29 ? ? -10.61 5 6 LYS A 11 ? ? 10.78 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 6 ? ? 0.101 'SIDE CHAIN' 2 3 ARG A 6 ? ? 0.088 'SIDE CHAIN' 3 4 ARG A 40 ? ? 0.097 'SIDE CHAIN' 4 5 ARG A 39 ? ? 0.135 'SIDE CHAIN' 5 7 ARG A 40 ? ? 0.123 'SIDE CHAIN' #