data_1HCT # _entry.id 1HCT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HCT pdb_00001hct 10.2210/pdb1hct/pdb WWPDB D_1000173785 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1HCS _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HCT _pdbx_database_status.recvd_initial_deposition_date 1994-09-02 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gampe Junior, R.T.' 1 'Xu, R.X.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of the human pp60c-src SH2 domain complexed with a phosphorylated tyrosine pentapeptide.' Biochemistry 34 2107 2121 1995 BICHAW US 0006-2960 0033 ? 7532003 10.1021/bi00007a003 1 'Peptide Inhibitors of Src SH3-Sh2(Slash)Phosphoprotein Interactions' J.Biol.Chem. 269 31711 ? 1994 JBCHA3 US 0021-9258 0071 ? ? ? 2 'Nuclear Magnetic Resonance Structure of an Sh2 Domain of Phospholipase C-Gamma1 Complexed with a High Affinity Binding Peptide' 'Cell(Cambridge,Mass.)' 77 461 ? 1994 CELLB5 US 0092-8674 0998 ? ? ? 3 'Binding of a High Affinity Phosphotyrosyl Peptide to the Src Sh2 Domain: Crystal Structures of the Complexed and Peptide-Free Forms' 'Cell(Cambridge,Mass.)' 72 779 ? 1993 CELLB5 US 0092-8674 0998 ? ? ? 4 'Recognition of a High-Affinity Phosphotyrosyl Peptide by the Src Homology-2 Domain of P56Lck' Nature 362 87 ? 1993 NATUAS UK 0028-0836 0006 ? ? ? 5 ;Human Cellular Src Gene: Nucleotide Sequence and Derived Amino Acid Sequence of the Region Coding for the Carboxy-Terminal Two-Thirds of Pp60C-Src ; Mol.Cell.Biol. 5 1122 ? 1985 MCEBD4 US 0270-7306 2044 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, R.X.' 1 ? primary 'Word, J.M.' 2 ? primary 'Davis, D.G.' 3 ? primary 'Rink, M.J.' 4 ? primary 'Willard Jr., D.H.' 5 ? primary 'Gampe Jr., R.T.' 6 ? 1 'Gilmer, T.' 7 ? 1 'Rodriguez, M.' 8 ? 1 'Jordan, S.' 9 ? 1 'Crosby, R.' 10 ? 1 'Alligood, K.' 11 ? 1 'Green, M.' 12 ? 1 'Kimery, M.' 13 ? 1 'Wagner, C.' 14 ? 1 'Kinder, D.' 15 ? 1 'Charifson, P.' 16 ? 1 'Hassell, A.M.' 17 ? 1 'Willard, D.' 18 ? 1 'Luther, M.' 19 ? 1 'Rusnak, D.' 20 ? 1 'Sternbach, D.D.' 21 ? 1 'Mehrotra, M.' 22 ? 1 'Peel, M.' 23 ? 1 'Shampine, L.' 24 ? 1 'Davis, R.' 25 ? 1 'Robbins, J.' 26 ? 1 'Patel, I.R.' 27 ? 1 'Kassel, D.' 28 ? 1 'Burkhart, W.' 29 ? 1 'Moyer, M.' 30 ? 1 'Bradshaw, T.' 31 ? 1 'Berman, J.' 32 ? 2 'Pascal, S.M.' 33 ? 2 'Singer, A.U.' 34 ? 2 'Gish, G.' 35 ? 2 'Yamazaki, T.' 36 ? 2 'Shoelson, S.E.' 37 ? 2 'Pawson, T.' 38 ? 2 'Kay, L.E.' 39 ? 2 'Forman-Kay, J.D.' 40 ? 3 'Waksman, G.' 41 ? 3 'Shoelson, S.E.' 42 ? 3 'Pant, N.' 43 ? 3 'Cowburn, D.' 44 ? 3 'Kuriyan, J.' 45 ? 4 'Eck, M.J.' 46 ? 4 'Shoelson, S.E.' 47 ? 4 'Harrison, S.C.' 48 ? 5 'Anderson, S.K.' 49 ? 5 'Gibbs, C.P.' 50 ? 5 'Tanaka, A.' 51 ? 5 'Kung, H.J.' 52 ? 5 'Fugita, D.J.' 53 ? # _cell.entry_id 1HCT _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HCT _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ACETYL-PYEEIE-OH 787.705 1 ? ? ? ? 2 polymer man 'HUMAN SRC' 12303.886 1 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name PP60==C-SRC== # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes '(ACE)(PTR)EEIE' XYEEIE A ? 2 'polypeptide(L)' no no ;MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQ FNSLQQLVAYYSKHADGLCHRLTTVCP ; ;MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQ FNSLQQLVAYYSKHADGLCHRLTTVCP ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 PTR n 1 3 GLU n 1 4 GLU n 1 5 ILE n 1 6 GLU n 2 1 MET n 2 2 ASP n 2 3 SER n 2 4 ILE n 2 5 GLN n 2 6 ALA n 2 7 GLU n 2 8 GLU n 2 9 TRP n 2 10 TYR n 2 11 PHE n 2 12 GLY n 2 13 LYS n 2 14 ILE n 2 15 THR n 2 16 ARG n 2 17 ARG n 2 18 GLU n 2 19 SER n 2 20 GLU n 2 21 ARG n 2 22 LEU n 2 23 LEU n 2 24 LEU n 2 25 ASN n 2 26 ALA n 2 27 GLU n 2 28 ASN n 2 29 PRO n 2 30 ARG n 2 31 GLY n 2 32 THR n 2 33 PHE n 2 34 LEU n 2 35 VAL n 2 36 ARG n 2 37 GLU n 2 38 SER n 2 39 GLU n 2 40 THR n 2 41 THR n 2 42 LYS n 2 43 GLY n 2 44 ALA n 2 45 TYR n 2 46 CYS n 2 47 LEU n 2 48 SER n 2 49 VAL n 2 50 SER n 2 51 ASP n 2 52 PHE n 2 53 ASP n 2 54 ASN n 2 55 ALA n 2 56 LYS n 2 57 GLY n 2 58 LEU n 2 59 ASN n 2 60 VAL n 2 61 LYS n 2 62 HIS n 2 63 TYR n 2 64 LYS n 2 65 ILE n 2 66 ARG n 2 67 LYS n 2 68 LEU n 2 69 ASP n 2 70 SER n 2 71 GLY n 2 72 GLY n 2 73 PHE n 2 74 TYR n 2 75 ILE n 2 76 THR n 2 77 SER n 2 78 ARG n 2 79 THR n 2 80 GLN n 2 81 PHE n 2 82 ASN n 2 83 SER n 2 84 LEU n 2 85 GLN n 2 86 GLN n 2 87 LEU n 2 88 VAL n 2 89 ALA n 2 90 TYR n 2 91 TYR n 2 92 SER n 2 93 LYS n 2 94 HIS n 2 95 ALA n 2 96 ASP n 2 97 GLY n 2 98 LEU n 2 99 CYS n 2 100 HIS n 2 101 ARG n 2 102 LEU n 2 103 THR n 2 104 THR n 2 105 VAL n 2 106 CYS n 2 107 PRO n # _entity_src_gen.entity_id 2 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'NUCLEOTIDE SEQUENCE A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 UNP SRC_HUMAN 2 P12931 1 ;GSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGP LAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRES ERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLC HRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLR HEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENL VCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERG YRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL ; ? 2 PDB 1HCT 1 1HCT ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1HCT B 2 ? 107 ? P12931 143 ? 248 ? 141 246 2 2 1HCT A 1 ? 6 ? 1HCT 100 ? 105 ? 100 105 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1HCT _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 23 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1HCT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1HCT _struct.title 'NMR STRUCTURE OF THE HUMAN SRC SH2 DOMAIN COMPLEX' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HCT _struct_keywords.pdbx_keywords 'COMPLEX (SIGNAL TRANSDUCTION/PEPTIDE)' _struct_keywords.text 'HUMAN PP60C-SRC SH2 DOMAIN, COMPLEX (SIGNAL TRANSDUCTION-PEPTIDE) COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE B 4 ? ALA B 6 ? ILE B 143 ALA B 145 5 ? 3 HELX_P HELX_P2 2 ARG B 16 ? LEU B 23 ? ARG B 155 LEU B 162 1 ? 8 HELX_P HELX_P3 3 LEU B 84 ? TYR B 91 ? LEU B 223 TYR B 230 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A PTR 2 N ? ? A ACE 100 A PTR 101 1_555 ? ? ? ? ? ? ? 1.306 ? ? covale2 covale both ? A PTR 2 C ? ? ? 1_555 A GLU 3 N ? ? A PTR 101 A GLU 102 1_555 ? ? ? ? ? ? ? 1.305 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE B 33 ? GLU B 37 ? PHE B 172 GLU B 176 A 2 TYR B 45 ? PHE B 52 ? TYR B 184 PHE B 191 A 3 LEU B 58 ? ILE B 65 ? LEU B 197 ILE B 204 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU B 34 ? O LEU B 173 N SER B 48 ? N SER B 187 A 2 3 O TYR B 45 ? O TYR B 184 N ILE B 65 ? N ILE B 204 # _database_PDB_matrix.entry_id 1HCT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HCT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 100 100 ACE ACE A . n A 1 2 PTR 2 101 101 PTR TYR A . n A 1 3 GLU 3 102 102 GLU GLU A . n A 1 4 GLU 4 103 103 GLU GLU A . n A 1 5 ILE 5 104 104 ILE ILE A . n A 1 6 GLU 6 105 105 GLU GLU A . n B 2 1 MET 1 140 140 MET MET B . n B 2 2 ASP 2 141 141 ASP ASP B . n B 2 3 SER 3 142 142 SER SER B . n B 2 4 ILE 4 143 143 ILE ILE B . n B 2 5 GLN 5 144 144 GLN GLN B . n B 2 6 ALA 6 145 145 ALA ALA B . n B 2 7 GLU 7 146 146 GLU GLU B . n B 2 8 GLU 8 147 147 GLU GLU B . n B 2 9 TRP 9 148 148 TRP TRP B . n B 2 10 TYR 10 149 149 TYR TYR B . n B 2 11 PHE 11 150 150 PHE PHE B . n B 2 12 GLY 12 151 151 GLY GLY B . n B 2 13 LYS 13 152 152 LYS LYS B . n B 2 14 ILE 14 153 153 ILE ILE B . n B 2 15 THR 15 154 154 THR THR B . n B 2 16 ARG 16 155 155 ARG ARG B . n B 2 17 ARG 17 156 156 ARG ARG B . n B 2 18 GLU 18 157 157 GLU GLU B . n B 2 19 SER 19 158 158 SER SER B . n B 2 20 GLU 20 159 159 GLU GLU B . n B 2 21 ARG 21 160 160 ARG ARG B . n B 2 22 LEU 22 161 161 LEU LEU B . n B 2 23 LEU 23 162 162 LEU LEU B . n B 2 24 LEU 24 163 163 LEU LEU B . n B 2 25 ASN 25 164 164 ASN ASN B . n B 2 26 ALA 26 165 165 ALA ALA B . n B 2 27 GLU 27 166 166 GLU GLU B . n B 2 28 ASN 28 167 167 ASN ASN B . n B 2 29 PRO 29 168 168 PRO PRO B . n B 2 30 ARG 30 169 169 ARG ARG B . n B 2 31 GLY 31 170 170 GLY GLY B . n B 2 32 THR 32 171 171 THR THR B . n B 2 33 PHE 33 172 172 PHE PHE B . n B 2 34 LEU 34 173 173 LEU LEU B . n B 2 35 VAL 35 174 174 VAL VAL B . n B 2 36 ARG 36 175 175 ARG ARG B . n B 2 37 GLU 37 176 176 GLU GLU B . n B 2 38 SER 38 177 177 SER SER B . n B 2 39 GLU 39 178 178 GLU GLU B . n B 2 40 THR 40 179 179 THR THR B . n B 2 41 THR 41 180 180 THR THR B . n B 2 42 LYS 42 181 181 LYS LYS B . n B 2 43 GLY 43 182 182 GLY GLY B . n B 2 44 ALA 44 183 183 ALA ALA B . n B 2 45 TYR 45 184 184 TYR TYR B . n B 2 46 CYS 46 185 185 CYS CYS B . n B 2 47 LEU 47 186 186 LEU LEU B . n B 2 48 SER 48 187 187 SER SER B . n B 2 49 VAL 49 188 188 VAL VAL B . n B 2 50 SER 50 189 189 SER SER B . n B 2 51 ASP 51 190 190 ASP ASP B . n B 2 52 PHE 52 191 191 PHE PHE B . n B 2 53 ASP 53 192 192 ASP ASP B . n B 2 54 ASN 54 193 193 ASN ASN B . n B 2 55 ALA 55 194 194 ALA ALA B . n B 2 56 LYS 56 195 195 LYS LYS B . n B 2 57 GLY 57 196 196 GLY GLY B . n B 2 58 LEU 58 197 197 LEU LEU B . n B 2 59 ASN 59 198 198 ASN ASN B . n B 2 60 VAL 60 199 199 VAL VAL B . n B 2 61 LYS 61 200 200 LYS LYS B . n B 2 62 HIS 62 201 201 HIS HIS B . n B 2 63 TYR 63 202 202 TYR TYR B . n B 2 64 LYS 64 203 203 LYS LYS B . n B 2 65 ILE 65 204 204 ILE ILE B . n B 2 66 ARG 66 205 205 ARG ARG B . n B 2 67 LYS 67 206 206 LYS LYS B . n B 2 68 LEU 68 207 207 LEU LEU B . n B 2 69 ASP 69 208 208 ASP ASP B . n B 2 70 SER 70 209 209 SER SER B . n B 2 71 GLY 71 210 210 GLY GLY B . n B 2 72 GLY 72 211 211 GLY GLY B . n B 2 73 PHE 73 212 212 PHE PHE B . n B 2 74 TYR 74 213 213 TYR TYR B . n B 2 75 ILE 75 214 214 ILE ILE B . n B 2 76 THR 76 215 215 THR THR B . n B 2 77 SER 77 216 216 SER SER B . n B 2 78 ARG 78 217 217 ARG ARG B . n B 2 79 THR 79 218 218 THR THR B . n B 2 80 GLN 80 219 219 GLN GLN B . n B 2 81 PHE 81 220 220 PHE PHE B . n B 2 82 ASN 82 221 221 ASN ASN B . n B 2 83 SER 83 222 222 SER SER B . n B 2 84 LEU 84 223 223 LEU LEU B . n B 2 85 GLN 85 224 224 GLN GLN B . n B 2 86 GLN 86 225 225 GLN GLN B . n B 2 87 LEU 87 226 226 LEU LEU B . n B 2 88 VAL 88 227 227 VAL VAL B . n B 2 89 ALA 89 228 228 ALA ALA B . n B 2 90 TYR 90 229 229 TYR TYR B . n B 2 91 TYR 91 230 230 TYR TYR B . n B 2 92 SER 92 231 231 SER SER B . n B 2 93 LYS 93 232 232 LYS LYS B . n B 2 94 HIS 94 233 233 HIS HIS B . n B 2 95 ALA 95 234 234 ALA ALA B . n B 2 96 ASP 96 235 235 ASP ASP B . n B 2 97 GLY 97 236 236 GLY GLY B . n B 2 98 LEU 98 237 237 LEU LEU B . n B 2 99 CYS 99 238 238 CYS CYS B . n B 2 100 HIS 100 239 239 HIS HIS B . n B 2 101 ARG 101 240 240 ARG ARG B . n B 2 102 LEU 102 241 241 LEU LEU B . n B 2 103 THR 103 242 242 THR THR B . n B 2 104 THR 104 243 243 THR THR B . n B 2 105 VAL 105 244 244 VAL VAL B . n B 2 106 CYS 106 245 245 CYS CYS B . n B 2 107 PRO 107 246 246 PRO PRO B . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 2 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 101 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-09-15 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA B 145 ? ? -170.32 45.26 2 1 GLU B 166 ? ? -89.61 32.87 3 1 LYS B 181 ? ? -56.15 -165.99 4 1 ALA B 183 ? ? -89.27 -150.73 5 1 LYS B 195 ? ? -146.12 -40.64 6 1 ASN B 198 ? ? -112.75 -169.34 7 1 TYR B 213 ? ? -179.30 89.59 8 1 SER B 231 ? ? -89.69 30.21 9 1 LYS B 232 ? ? -150.23 -41.42 10 1 THR B 242 ? ? -133.75 -37.68 11 2 GLU A 102 ? ? -53.40 -176.82 12 2 ASP B 141 ? ? -149.62 57.47 13 2 ARG B 169 ? ? -55.36 98.67 14 2 ASN B 193 ? ? -101.61 56.55 15 2 ALA B 194 ? ? -150.08 -69.33 16 2 TYR B 213 ? ? -178.96 137.09 17 2 THR B 215 ? ? -134.67 -149.46 18 2 ARG B 217 ? ? 168.12 -27.50 19 2 HIS B 239 ? ? 177.47 139.36 20 2 THR B 242 ? ? -135.95 -37.90 21 3 ASP B 141 ? ? -177.28 48.18 22 3 LEU B 163 ? ? -103.09 58.99 23 3 ALA B 183 ? ? -89.88 -150.58 24 3 ASN B 193 ? ? -86.79 49.78 25 3 ALA B 194 ? ? -132.99 -49.18 26 3 LYS B 195 ? ? -126.08 -67.36 27 3 TYR B 213 ? ? -178.11 114.90 28 3 ARG B 217 ? ? -147.32 -39.62 29 3 SER B 222 ? ? -177.41 141.62 30 3 HIS B 239 ? ? 179.10 126.78 31 3 THR B 242 ? ? -138.21 -39.24 32 4 ASP B 141 ? ? 65.76 148.40 33 4 SER B 142 ? ? 170.97 155.16 34 4 ALA B 145 ? ? -150.41 44.18 35 4 ASN B 164 ? ? -140.15 37.84 36 4 ALA B 165 ? ? 37.12 30.96 37 4 THR B 180 ? ? -106.68 71.71 38 4 LYS B 195 ? ? -137.06 -38.18 39 4 TYR B 213 ? ? -179.06 135.16 40 4 ARG B 217 ? ? -148.68 -39.83 41 4 HIS B 239 ? ? 178.73 139.06 42 5 ALA B 165 ? ? 38.68 28.64 43 5 GLU B 166 ? ? -152.80 18.34 44 5 SER B 177 ? ? -45.47 -81.92 45 5 GLU B 178 ? ? 83.68 -45.63 46 5 THR B 180 ? ? -100.51 -164.07 47 5 ASN B 193 ? ? -90.27 53.77 48 5 ALA B 194 ? ? -154.63 -59.69 49 5 LYS B 195 ? ? -97.91 -74.15 50 5 TYR B 213 ? ? -178.42 120.17 51 5 ARG B 217 ? ? -144.93 -39.69 52 5 HIS B 239 ? ? -178.72 139.19 53 6 ASP B 141 ? ? -90.79 56.15 54 6 GLU B 166 ? ? -90.28 31.88 55 6 ALA B 194 ? ? -159.41 40.82 56 6 LYS B 195 ? ? -148.14 16.95 57 6 TYR B 213 ? ? 179.50 103.56 58 6 SER B 216 ? ? -85.24 46.17 59 6 SER B 222 ? ? -176.53 145.71 60 6 ASP B 235 ? ? 62.58 -114.38 61 6 HIS B 239 ? ? -170.54 145.10 62 7 ASN B 193 ? ? -90.37 35.83 63 7 LYS B 195 ? ? -131.68 -58.46 64 7 TYR B 213 ? ? -171.97 137.08 65 7 ARG B 217 ? ? -162.99 -37.75 66 7 HIS B 239 ? ? 173.20 38.23 67 7 ARG B 240 ? ? 62.16 143.96 68 7 THR B 242 ? ? -130.71 -38.49 69 8 SER B 142 ? ? -116.90 -167.36 70 8 SER B 177 ? ? -49.50 99.10 71 8 ALA B 194 ? ? -161.78 -43.33 72 8 LYS B 195 ? ? -106.71 -70.39 73 8 TYR B 213 ? ? -179.53 131.83 74 8 LYS B 232 ? ? -140.61 -48.11 75 8 HIS B 239 ? ? 179.58 121.75 76 9 ASP B 141 ? ? 53.05 72.32 77 9 SER B 142 ? ? -119.88 54.95 78 9 GLU B 146 ? ? -48.33 160.54 79 9 GLU B 166 ? ? -95.63 31.53 80 9 ARG B 169 ? ? -45.48 167.15 81 9 THR B 180 ? ? -100.39 -163.35 82 9 ALA B 194 ? ? -160.09 -41.60 83 9 TYR B 213 ? ? -178.77 114.20 84 9 ARG B 217 ? ? -154.04 -39.69 85 9 LYS B 232 ? ? -150.19 -48.74 86 9 LEU B 237 ? ? -53.77 -177.97 87 9 THR B 242 ? ? -133.73 -34.71 88 10 SER B 142 ? ? 61.49 118.91 89 10 GLU B 166 ? ? -89.32 36.05 90 10 ARG B 169 ? ? -97.15 34.74 91 10 LEU B 173 ? ? -171.49 141.56 92 10 GLU B 178 ? ? 83.49 -46.00 93 10 LYS B 181 ? ? -48.53 107.88 94 10 TYR B 184 ? ? -114.93 -164.70 95 10 ASN B 193 ? ? -90.30 32.69 96 10 ALA B 194 ? ? -170.04 -43.85 97 10 LYS B 195 ? ? -77.14 -76.99 98 10 TYR B 213 ? ? -173.88 120.33 99 10 ARG B 217 ? ? -165.76 -36.42 100 10 LYS B 232 ? ? -147.93 -46.11 101 10 ASP B 235 ? ? 62.02 -111.80 102 10 HIS B 239 ? ? 179.52 149.82 103 11 ALA B 145 ? ? -148.33 22.08 104 11 GLU B 146 ? ? -49.30 163.75 105 11 LYS B 152 ? ? -152.30 87.35 106 11 THR B 154 ? ? -65.97 -176.89 107 11 LEU B 163 ? ? -91.43 47.99 108 11 PRO B 168 ? ? -77.87 -166.68 109 11 ARG B 169 ? ? -89.88 34.62 110 11 SER B 177 ? ? -52.23 90.58 111 11 THR B 180 ? ? -105.38 -162.93 112 11 ALA B 183 ? ? -115.15 -151.82 113 11 ALA B 194 ? ? -88.92 -87.09 114 11 ASN B 198 ? ? -114.81 -161.08 115 11 TYR B 213 ? ? -178.19 135.94 116 11 SER B 216 ? ? -91.25 31.22 117 11 LYS B 232 ? ? -142.61 -39.12 118 11 LEU B 237 ? ? -47.14 171.79 119 11 HIS B 239 ? ? -175.76 128.65 120 11 ARG B 240 ? ? -45.82 150.03 121 12 SER B 142 ? ? -55.45 104.71 122 12 GLU B 166 ? ? -89.99 34.64 123 12 SER B 177 ? ? -59.58 89.75 124 12 GLU B 178 ? ? -69.89 -72.90 125 12 ASN B 193 ? ? -98.34 34.23 126 12 LYS B 195 ? ? -138.91 -62.08 127 12 TYR B 213 ? ? -178.40 136.29 128 12 ARG B 217 ? ? -149.80 -40.13 129 12 SER B 222 ? ? -175.00 149.80 130 12 LYS B 232 ? ? -150.19 -39.12 131 12 ASP B 235 ? ? 45.17 26.94 132 12 HIS B 239 ? ? 176.51 43.79 133 12 ARG B 240 ? ? 55.25 170.46 134 12 THR B 242 ? ? -136.87 -41.04 135 13 ASP B 141 ? ? 55.02 172.91 136 13 LEU B 163 ? ? -86.44 47.71 137 13 ARG B 169 ? ? -96.03 38.98 138 13 LEU B 173 ? ? -171.78 142.31 139 13 SER B 177 ? ? -46.76 -93.23 140 13 GLU B 178 ? ? 83.57 -45.04 141 13 THR B 180 ? ? -106.59 -163.65 142 13 LYS B 181 ? ? -100.77 78.74 143 13 ALA B 183 ? ? -109.64 -151.28 144 13 ALA B 194 ? ? -159.72 -47.00 145 13 TYR B 213 ? ? -178.03 132.49 146 13 SER B 216 ? ? -89.52 36.49 147 13 HIS B 239 ? ? 178.93 136.46 148 14 ALA B 145 ? ? -92.80 -93.93 149 14 GLU B 146 ? ? 60.00 121.52 150 14 LYS B 152 ? ? -110.97 63.49 151 14 GLU B 166 ? ? -87.82 30.67 152 14 SER B 177 ? ? -64.97 89.96 153 14 GLU B 178 ? ? -61.03 -76.46 154 14 ASN B 193 ? ? -86.27 47.17 155 14 ALA B 194 ? ? -158.87 -53.04 156 14 LYS B 195 ? ? -97.25 -88.62 157 14 TYR B 213 ? ? -177.81 88.75 158 14 SER B 216 ? ? -85.06 42.32 159 14 LEU B 237 ? ? -62.55 -173.54 160 14 HIS B 239 ? ? 178.96 139.10 161 14 THR B 242 ? ? -130.47 -41.32 162 15 SER B 142 ? ? -166.63 -151.38 163 15 ALA B 145 ? ? -95.30 -90.97 164 15 GLU B 146 ? ? 60.24 119.69 165 15 THR B 180 ? ? -117.47 -165.87 166 15 ALA B 194 ? ? -76.97 -72.79 167 15 TYR B 213 ? ? -176.33 133.25 168 15 ARG B 217 ? ? -155.96 -39.47 169 15 LYS B 232 ? ? -150.40 -38.73 170 15 HIS B 239 ? ? 179.95 142.37 171 15 THR B 242 ? ? -131.29 -35.06 172 16 SER B 142 ? ? 63.06 171.49 173 16 LEU B 163 ? ? -106.79 79.69 174 16 SER B 177 ? ? -52.74 90.95 175 16 ALA B 194 ? ? -145.81 -63.04 176 16 ASN B 198 ? ? -109.75 -169.08 177 16 TYR B 213 ? ? -178.50 97.44 178 16 LYS B 232 ? ? -147.84 -40.34 179 16 HIS B 239 ? ? 178.31 141.38 180 16 THR B 242 ? ? -149.95 -42.10 181 17 ALA B 145 ? ? -142.40 53.63 182 17 LEU B 163 ? ? -87.13 44.49 183 17 ASN B 193 ? ? -86.26 46.85 184 17 ALA B 194 ? ? -135.07 -43.89 185 17 LYS B 195 ? ? -129.01 -70.47 186 17 TYR B 213 ? ? -178.56 137.52 187 17 SER B 216 ? ? -90.54 31.28 188 17 LYS B 232 ? ? -125.62 -50.58 189 17 HIS B 239 ? ? -177.73 129.47 190 18 ALA B 145 ? ? -92.14 -88.57 191 18 GLU B 146 ? ? 60.98 123.66 192 18 THR B 180 ? ? -101.31 -164.20 193 18 ALA B 183 ? ? -92.78 -153.40 194 18 ASN B 193 ? ? -86.32 46.28 195 18 ALA B 194 ? ? -170.03 -40.59 196 18 TYR B 213 ? ? -173.91 137.05 197 18 ARG B 217 ? ? -167.54 -36.35 198 18 LEU B 237 ? ? -55.81 -168.94 199 18 HIS B 239 ? ? -179.73 149.42 200 19 GLU B 178 ? ? 82.67 -43.88 201 19 LYS B 181 ? ? -54.32 106.77 202 19 ASN B 193 ? ? -90.64 52.24 203 19 ALA B 194 ? ? -137.37 -73.78 204 19 TYR B 213 ? ? -173.40 129.04 205 19 SER B 216 ? ? -89.39 36.00 206 19 LEU B 237 ? ? -51.34 -178.83 207 19 HIS B 239 ? ? -179.11 125.31 208 20 SER B 142 ? ? 72.99 165.22 209 20 LEU B 163 ? ? -90.96 36.59 210 20 ASN B 193 ? ? -96.70 31.98 211 20 LYS B 195 ? ? -129.24 -73.49 212 20 TYR B 213 ? ? -178.39 136.19 213 20 ARG B 217 ? ? -167.82 -35.86 214 20 LYS B 232 ? ? -141.07 -46.93 215 20 THR B 242 ? ? -136.17 -37.40 216 21 ASP B 141 ? ? -176.51 66.77 217 21 SER B 142 ? ? 62.16 124.39 218 21 LEU B 163 ? ? -102.22 71.81 219 21 LYS B 181 ? ? -56.73 -163.25 220 21 LYS B 195 ? ? -109.96 -63.86 221 21 TYR B 213 ? ? -178.22 128.29 222 21 SER B 216 ? ? -90.06 33.09 223 21 LYS B 232 ? ? -144.39 -41.95 224 22 ASP B 141 ? ? 48.82 -164.69 225 22 ALA B 165 ? ? 37.86 29.11 226 22 GLU B 166 ? ? -145.12 15.99 227 22 GLU B 178 ? ? 83.75 -44.44 228 22 ASN B 193 ? ? -93.30 30.94 229 22 ALA B 194 ? ? -112.49 -87.07 230 22 TYR B 213 ? ? -177.90 138.21 231 22 ARG B 217 ? ? -164.07 -37.65 232 22 LYS B 232 ? ? -145.87 -37.58 233 22 LEU B 237 ? ? -58.02 -165.19 234 22 HIS B 239 ? ? 179.36 141.46 235 22 THR B 242 ? ? -137.67 -43.20 236 23 ASP B 141 ? ? -63.82 99.31 237 23 ARG B 169 ? ? -57.50 106.22 238 23 SER B 177 ? ? -55.36 103.27 239 23 GLU B 178 ? ? -71.35 -70.33 240 23 ASN B 193 ? ? -86.27 45.94 241 23 ALA B 194 ? ? -146.57 -60.65 242 23 LYS B 195 ? ? -95.45 -79.30 243 23 TYR B 213 ? ? -178.48 124.50 244 23 ARG B 217 ? ? -153.95 -39.56 245 23 SER B 222 ? ? -173.22 147.30 246 23 LYS B 232 ? ? -150.35 -39.58 247 23 ASP B 235 ? ? 63.58 -111.37 248 23 HIS B 239 ? ? 178.82 138.92 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG B 155 ? ? 0.286 'SIDE CHAIN' 2 1 ARG B 156 ? ? 0.317 'SIDE CHAIN' 3 1 ARG B 160 ? ? 0.315 'SIDE CHAIN' 4 1 ARG B 169 ? ? 0.200 'SIDE CHAIN' 5 1 ARG B 175 ? ? 0.311 'SIDE CHAIN' 6 1 ARG B 205 ? ? 0.316 'SIDE CHAIN' 7 1 ARG B 217 ? ? 0.186 'SIDE CHAIN' 8 1 ARG B 240 ? ? 0.268 'SIDE CHAIN' 9 2 ARG B 155 ? ? 0.237 'SIDE CHAIN' 10 2 ARG B 156 ? ? 0.312 'SIDE CHAIN' 11 2 ARG B 160 ? ? 0.316 'SIDE CHAIN' 12 2 ARG B 169 ? ? 0.222 'SIDE CHAIN' 13 2 ARG B 175 ? ? 0.207 'SIDE CHAIN' 14 2 ARG B 205 ? ? 0.311 'SIDE CHAIN' 15 2 ARG B 217 ? ? 0.317 'SIDE CHAIN' 16 2 ARG B 240 ? ? 0.267 'SIDE CHAIN' 17 3 ARG B 155 ? ? 0.303 'SIDE CHAIN' 18 3 ARG B 156 ? ? 0.300 'SIDE CHAIN' 19 3 ARG B 160 ? ? 0.275 'SIDE CHAIN' 20 3 ARG B 169 ? ? 0.298 'SIDE CHAIN' 21 3 ARG B 175 ? ? 0.277 'SIDE CHAIN' 22 3 ARG B 205 ? ? 0.244 'SIDE CHAIN' 23 3 ARG B 217 ? ? 0.239 'SIDE CHAIN' 24 3 ARG B 240 ? ? 0.309 'SIDE CHAIN' 25 4 ARG B 155 ? ? 0.316 'SIDE CHAIN' 26 4 ARG B 156 ? ? 0.310 'SIDE CHAIN' 27 4 ARG B 160 ? ? 0.317 'SIDE CHAIN' 28 4 ARG B 169 ? ? 0.317 'SIDE CHAIN' 29 4 ARG B 175 ? ? 0.289 'SIDE CHAIN' 30 4 ARG B 205 ? ? 0.317 'SIDE CHAIN' 31 4 ARG B 217 ? ? 0.318 'SIDE CHAIN' 32 4 ARG B 240 ? ? 0.309 'SIDE CHAIN' 33 5 ARG B 155 ? ? 0.274 'SIDE CHAIN' 34 5 ARG B 156 ? ? 0.317 'SIDE CHAIN' 35 5 ARG B 160 ? ? 0.178 'SIDE CHAIN' 36 5 ARG B 169 ? ? 0.310 'SIDE CHAIN' 37 5 ARG B 175 ? ? 0.169 'SIDE CHAIN' 38 5 ARG B 205 ? ? 0.139 'SIDE CHAIN' 39 5 ARG B 217 ? ? 0.307 'SIDE CHAIN' 40 5 ARG B 240 ? ? 0.317 'SIDE CHAIN' 41 6 ARG B 155 ? ? 0.312 'SIDE CHAIN' 42 6 ARG B 156 ? ? 0.177 'SIDE CHAIN' 43 6 ARG B 160 ? ? 0.266 'SIDE CHAIN' 44 6 ARG B 169 ? ? 0.292 'SIDE CHAIN' 45 6 ARG B 175 ? ? 0.195 'SIDE CHAIN' 46 6 ARG B 205 ? ? 0.121 'SIDE CHAIN' 47 6 ARG B 217 ? ? 0.261 'SIDE CHAIN' 48 6 ARG B 240 ? ? 0.245 'SIDE CHAIN' 49 7 ARG B 155 ? ? 0.287 'SIDE CHAIN' 50 7 ARG B 156 ? ? 0.316 'SIDE CHAIN' 51 7 ARG B 160 ? ? 0.181 'SIDE CHAIN' 52 7 ARG B 169 ? ? 0.228 'SIDE CHAIN' 53 7 ARG B 175 ? ? 0.130 'SIDE CHAIN' 54 7 ARG B 205 ? ? 0.317 'SIDE CHAIN' 55 7 ARG B 217 ? ? 0.275 'SIDE CHAIN' 56 7 ARG B 240 ? ? 0.170 'SIDE CHAIN' 57 8 ARG B 155 ? ? 0.180 'SIDE CHAIN' 58 8 ARG B 156 ? ? 0.307 'SIDE CHAIN' 59 8 ARG B 160 ? ? 0.234 'SIDE CHAIN' 60 8 ARG B 169 ? ? 0.304 'SIDE CHAIN' 61 8 ARG B 175 ? ? 0.315 'SIDE CHAIN' 62 8 ARG B 205 ? ? 0.163 'SIDE CHAIN' 63 8 ARG B 217 ? ? 0.233 'SIDE CHAIN' 64 8 ARG B 240 ? ? 0.303 'SIDE CHAIN' 65 9 ARG B 155 ? ? 0.264 'SIDE CHAIN' 66 9 ARG B 156 ? ? 0.294 'SIDE CHAIN' 67 9 ARG B 160 ? ? 0.107 'SIDE CHAIN' 68 9 ARG B 169 ? ? 0.129 'SIDE CHAIN' 69 9 ARG B 175 ? ? 0.216 'SIDE CHAIN' 70 9 ARG B 205 ? ? 0.305 'SIDE CHAIN' 71 9 ARG B 217 ? ? 0.240 'SIDE CHAIN' 72 9 ARG B 240 ? ? 0.258 'SIDE CHAIN' 73 10 ARG B 155 ? ? 0.261 'SIDE CHAIN' 74 10 ARG B 156 ? ? 0.261 'SIDE CHAIN' 75 10 ARG B 160 ? ? 0.318 'SIDE CHAIN' 76 10 ARG B 169 ? ? 0.252 'SIDE CHAIN' 77 10 ARG B 175 ? ? 0.159 'SIDE CHAIN' 78 10 ARG B 205 ? ? 0.166 'SIDE CHAIN' 79 10 ARG B 217 ? ? 0.132 'SIDE CHAIN' 80 10 ARG B 240 ? ? 0.242 'SIDE CHAIN' 81 11 ARG B 155 ? ? 0.312 'SIDE CHAIN' 82 11 ARG B 156 ? ? 0.283 'SIDE CHAIN' 83 11 ARG B 160 ? ? 0.212 'SIDE CHAIN' 84 11 ARG B 169 ? ? 0.300 'SIDE CHAIN' 85 11 ARG B 175 ? ? 0.301 'SIDE CHAIN' 86 11 ARG B 205 ? ? 0.315 'SIDE CHAIN' 87 11 ARG B 217 ? ? 0.168 'SIDE CHAIN' 88 11 ARG B 240 ? ? 0.138 'SIDE CHAIN' 89 12 ARG B 155 ? ? 0.294 'SIDE CHAIN' 90 12 ARG B 156 ? ? 0.299 'SIDE CHAIN' 91 12 ARG B 160 ? ? 0.298 'SIDE CHAIN' 92 12 ARG B 169 ? ? 0.233 'SIDE CHAIN' 93 12 ARG B 175 ? ? 0.221 'SIDE CHAIN' 94 12 ARG B 205 ? ? 0.206 'SIDE CHAIN' 95 12 ARG B 217 ? ? 0.317 'SIDE CHAIN' 96 12 ARG B 240 ? ? 0.158 'SIDE CHAIN' 97 13 ARG B 155 ? ? 0.152 'SIDE CHAIN' 98 13 ARG B 156 ? ? 0.305 'SIDE CHAIN' 99 13 ARG B 160 ? ? 0.211 'SIDE CHAIN' 100 13 ARG B 169 ? ? 0.131 'SIDE CHAIN' 101 13 ARG B 175 ? ? 0.135 'SIDE CHAIN' 102 13 ARG B 205 ? ? 0.297 'SIDE CHAIN' 103 13 ARG B 217 ? ? 0.317 'SIDE CHAIN' 104 14 ARG B 155 ? ? 0.173 'SIDE CHAIN' 105 14 ARG B 156 ? ? 0.307 'SIDE CHAIN' 106 14 ARG B 160 ? ? 0.281 'SIDE CHAIN' 107 14 ARG B 169 ? ? 0.185 'SIDE CHAIN' 108 14 ARG B 175 ? ? 0.318 'SIDE CHAIN' 109 14 ARG B 205 ? ? 0.294 'SIDE CHAIN' 110 14 ARG B 217 ? ? 0.292 'SIDE CHAIN' 111 14 ARG B 240 ? ? 0.225 'SIDE CHAIN' 112 15 ARG B 155 ? ? 0.317 'SIDE CHAIN' 113 15 ARG B 156 ? ? 0.301 'SIDE CHAIN' 114 15 ARG B 160 ? ? 0.316 'SIDE CHAIN' 115 15 ARG B 169 ? ? 0.142 'SIDE CHAIN' 116 15 ARG B 175 ? ? 0.313 'SIDE CHAIN' 117 15 ARG B 205 ? ? 0.285 'SIDE CHAIN' 118 15 ARG B 217 ? ? 0.286 'SIDE CHAIN' 119 15 ARG B 240 ? ? 0.101 'SIDE CHAIN' 120 16 ARG B 155 ? ? 0.295 'SIDE CHAIN' 121 16 ARG B 156 ? ? 0.315 'SIDE CHAIN' 122 16 ARG B 160 ? ? 0.304 'SIDE CHAIN' 123 16 ARG B 169 ? ? 0.239 'SIDE CHAIN' 124 16 ARG B 175 ? ? 0.241 'SIDE CHAIN' 125 16 ARG B 205 ? ? 0.235 'SIDE CHAIN' 126 16 ARG B 217 ? ? 0.312 'SIDE CHAIN' 127 16 ARG B 240 ? ? 0.252 'SIDE CHAIN' 128 17 ARG B 155 ? ? 0.270 'SIDE CHAIN' 129 17 ARG B 156 ? ? 0.264 'SIDE CHAIN' 130 17 ARG B 160 ? ? 0.289 'SIDE CHAIN' 131 17 ARG B 169 ? ? 0.179 'SIDE CHAIN' 132 17 ARG B 175 ? ? 0.243 'SIDE CHAIN' 133 17 ARG B 205 ? ? 0.315 'SIDE CHAIN' 134 17 ARG B 217 ? ? 0.125 'SIDE CHAIN' 135 17 ARG B 240 ? ? 0.298 'SIDE CHAIN' 136 18 ARG B 155 ? ? 0.316 'SIDE CHAIN' 137 18 ARG B 156 ? ? 0.172 'SIDE CHAIN' 138 18 ARG B 160 ? ? 0.233 'SIDE CHAIN' 139 18 ARG B 169 ? ? 0.282 'SIDE CHAIN' 140 18 ARG B 175 ? ? 0.300 'SIDE CHAIN' 141 18 ARG B 205 ? ? 0.226 'SIDE CHAIN' 142 18 ARG B 217 ? ? 0.203 'SIDE CHAIN' 143 18 ARG B 240 ? ? 0.315 'SIDE CHAIN' 144 19 ARG B 155 ? ? 0.140 'SIDE CHAIN' 145 19 ARG B 156 ? ? 0.275 'SIDE CHAIN' 146 19 ARG B 160 ? ? 0.316 'SIDE CHAIN' 147 19 ARG B 169 ? ? 0.249 'SIDE CHAIN' 148 19 ARG B 175 ? ? 0.233 'SIDE CHAIN' 149 19 ARG B 205 ? ? 0.318 'SIDE CHAIN' 150 19 ARG B 217 ? ? 0.293 'SIDE CHAIN' 151 19 ARG B 240 ? ? 0.237 'SIDE CHAIN' 152 20 ARG B 155 ? ? 0.267 'SIDE CHAIN' 153 20 ARG B 156 ? ? 0.299 'SIDE CHAIN' 154 20 ARG B 160 ? ? 0.312 'SIDE CHAIN' 155 20 ARG B 169 ? ? 0.245 'SIDE CHAIN' 156 20 ARG B 175 ? ? 0.316 'SIDE CHAIN' 157 20 ARG B 205 ? ? 0.099 'SIDE CHAIN' 158 20 ARG B 217 ? ? 0.284 'SIDE CHAIN' 159 20 ARG B 240 ? ? 0.226 'SIDE CHAIN' 160 21 ARG B 155 ? ? 0.136 'SIDE CHAIN' 161 21 ARG B 156 ? ? 0.313 'SIDE CHAIN' 162 21 ARG B 160 ? ? 0.317 'SIDE CHAIN' 163 21 ARG B 169 ? ? 0.226 'SIDE CHAIN' 164 21 ARG B 175 ? ? 0.247 'SIDE CHAIN' 165 21 ARG B 205 ? ? 0.317 'SIDE CHAIN' 166 21 ARG B 217 ? ? 0.252 'SIDE CHAIN' 167 21 ARG B 240 ? ? 0.208 'SIDE CHAIN' 168 22 ARG B 155 ? ? 0.249 'SIDE CHAIN' 169 22 ARG B 156 ? ? 0.308 'SIDE CHAIN' 170 22 ARG B 160 ? ? 0.220 'SIDE CHAIN' 171 22 ARG B 169 ? ? 0.276 'SIDE CHAIN' 172 22 ARG B 175 ? ? 0.254 'SIDE CHAIN' 173 22 ARG B 205 ? ? 0.287 'SIDE CHAIN' 174 22 ARG B 217 ? ? 0.316 'SIDE CHAIN' 175 22 ARG B 240 ? ? 0.260 'SIDE CHAIN' 176 23 ARG B 155 ? ? 0.216 'SIDE CHAIN' 177 23 ARG B 156 ? ? 0.232 'SIDE CHAIN' 178 23 ARG B 160 ? ? 0.113 'SIDE CHAIN' 179 23 ARG B 169 ? ? 0.310 'SIDE CHAIN' 180 23 ARG B 175 ? ? 0.258 'SIDE CHAIN' 181 23 ARG B 205 ? ? 0.117 'SIDE CHAIN' 182 23 ARG B 217 ? ? 0.258 'SIDE CHAIN' 183 23 ARG B 240 ? ? 0.209 'SIDE CHAIN' #