data_1HQB # _entry.id 1HQB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HQB pdb_00001hqb 10.2210/pdb1hqb/pdb RCSB RCSB012513 ? ? WWPDB D_1000012513 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1ACP _pdbx_database_related.details 'FAS Acyl carrier protein from E. coli.' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HQB _pdbx_database_status.recvd_initial_deposition_date 2000-12-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Volkman, B.F.' 1 'Zhang, Q.' 2 'Debabov, D.V.' 3 'Rivera, E.' 4 'Kresheck, G.' 5 'Neuhaus, F.C.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Biosynthesis of D-alanyl-lipoteichoic acid: the tertiary structure of apo-D-alanyl carrier protein.' Biochemistry 40 7964 7972 2001 BICHAW US 0006-2960 0033 ? 11434765 10.1021/bi010355a 1 'The D-Alanyl Carrier Protein in Lactobacillus Casei: Cloning, Sequencing and Expression of Dltc' J.Bacteriol. 178 3869 3876 1996 JOBAAY US 0021-9193 0767 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Volkman, B.F.' 1 ? primary 'Zhang, Q.' 2 ? primary 'Debabov, D.V.' 3 ? primary 'Rivera, E.' 4 ? primary 'Kresheck, G.C.' 5 ? primary 'Neuhaus, F.C.' 6 ? 1 'Debabov, D.V.' 7 ? 1 'Heaton, M.P.' 8 ? 1 'Zhang, Q.' 9 ? 1 'Stewart, K.D.' 10 ? 1 'Lambalot, R.H.' 11 ? 1 'Neuhaus, F.C.' 12 ? # _cell.entry_id 1HQB _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HQB _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'APO-D-ALANYL CARRIER PROTEIN' _entity.formula_weight 8795.818 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RESIDUES 2-81' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name APO-DCP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ _entity_poly.pdbx_seq_one_letter_code_can ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 GLU n 1 4 ALA n 1 5 ILE n 1 6 LYS n 1 7 ASN n 1 8 GLY n 1 9 VAL n 1 10 LEU n 1 11 ASP n 1 12 ILE n 1 13 LEU n 1 14 ALA n 1 15 ASP n 1 16 LEU n 1 17 THR n 1 18 GLY n 1 19 SER n 1 20 ASP n 1 21 ASP n 1 22 VAL n 1 23 LYS n 1 24 LYS n 1 25 ASN n 1 26 LEU n 1 27 ASP n 1 28 LEU n 1 29 ASN n 1 30 LEU n 1 31 PHE n 1 32 GLU n 1 33 THR n 1 34 GLY n 1 35 LEU n 1 36 LEU n 1 37 ASP n 1 38 SER n 1 39 MET n 1 40 GLY n 1 41 THR n 1 42 VAL n 1 43 GLN n 1 44 LEU n 1 45 LEU n 1 46 LEU n 1 47 GLU n 1 48 LEU n 1 49 GLN n 1 50 SER n 1 51 GLN n 1 52 PHE n 1 53 GLY n 1 54 VAL n 1 55 ASP n 1 56 ALA n 1 57 PRO n 1 58 VAL n 1 59 SER n 1 60 GLU n 1 61 PHE n 1 62 ASP n 1 63 ARG n 1 64 LYS n 1 65 GLU n 1 66 TRP n 1 67 ASP n 1 68 THR n 1 69 PRO n 1 70 ASN n 1 71 LYS n 1 72 ILE n 1 73 ILE n 1 74 ALA n 1 75 LYS n 1 76 VAL n 1 77 GLU n 1 78 GLN n 1 79 ALA n 1 80 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lactobacillus _entity_src_gen.pdbx_gene_src_gene DLTC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactobacillus casei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1582 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PDCP1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DLTC_LACRH _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_accession P55153 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HQB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P55153 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 81 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-SEPARATED_NOESY 1 2 1 3D_13C-SEPARATED_NOESY 1 3 1 '2D 15N-FILTERED NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.00 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 5.80 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM PHOSPHATE' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2 MM [U-15N]APO-DCP, 50 MM PHOSPHATE BUFFER' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1HQB _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;THE STRUCTURES ARE BASED ON A TOTAL OF 1582 NON-TRIVIAL UPPER-LIMIT DISTANCE CONSTRAINTS (332 LONG-RANGE, 560 MEDIUM-RANGE, 372 SEQUENTIAL AND 318 INTRARESIDUE), DERIVED FROM 3288 ASSIGNED NOES FROM 4 2D AND 3D SPECTRA. THIS CORRESPONDS TO AN AVERAGE OF 19.8 CONSTRAINTS/RESIDUE. NO ADDITIONAL CONSTRAINTS WERE INCLUDED. STRUCTURES WERE GENERATED USING THE ANNEAL FUNCTION OF THE PROGRAM DYANA 1.5, WITH 8000 TORSION ANGLE DYNAMICS STEPS FOR EACH STRUCTURE. THE AVERAGE DYANA TARGET FUNCTION FOR THE 30 CONFORMERS WAS 0.68 +/- 0.11. THE AVERAGE BACKBONE ATOMIC RMSD TO THE MEAN STRUCTURE FOR RESIDUES 4-81 IS 0.43 +/- 0.08 ANGSTROMS, AND 0.86 +/- 0.09 FOR ALL NON-HYDROGEN ATOMS (RESIDUES 4-81). ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1HQB _pdbx_nmr_details.text 'COMPLETE RESONANCE ASSIGNMENTS OBTAINED WITH TRIPLE-RESONANCE NMR DATA AS DESCRIBED IN THE PRIMARY CITATION.' # _pdbx_nmr_ensemble.entry_id 1HQB _pdbx_nmr_ensemble.conformers_calculated_total_number 1 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria . _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1HQB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DYANA 1.5 'PETER GUNTERT' 1 processing Felix 95 MSI 2 processing NMRPipe ? 'Frank Delaglio, NIH' 3 collection XwinNMR 2.3 Bruker 4 'data analysis' XEASY 1.3 Guntert 5 # _exptl.entry_id 1HQB _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1HQB _struct.title 'TERTIARY STRUCTURE OF APO-D-ALANYL CARRIER PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1HQB _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text '3-HELIX BUNDLE, TRANSPORT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? GLY A 18 ? ASP A 3 GLY A 19 1 ? 17 HELX_P HELX_P2 2 SER A 38 ? GLN A 49 ? SER A 39 GLN A 50 1 ? 12 HELX_P HELX_P3 3 THR A 68 ? GLN A 78 ? THR A 69 GLN A 79 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1HQB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HQB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 2 ALA ALA A . n A 1 2 ASP 2 3 3 ASP ASP A . n A 1 3 GLU 3 4 4 GLU GLU A . n A 1 4 ALA 4 5 5 ALA ALA A . n A 1 5 ILE 5 6 6 ILE ILE A . n A 1 6 LYS 6 7 7 LYS LYS A . n A 1 7 ASN 7 8 8 ASN ASN A . n A 1 8 GLY 8 9 9 GLY GLY A . n A 1 9 VAL 9 10 10 VAL VAL A . n A 1 10 LEU 10 11 11 LEU LEU A . n A 1 11 ASP 11 12 12 ASP ASP A . n A 1 12 ILE 12 13 13 ILE ILE A . n A 1 13 LEU 13 14 14 LEU LEU A . n A 1 14 ALA 14 15 15 ALA ALA A . n A 1 15 ASP 15 16 16 ASP ASP A . n A 1 16 LEU 16 17 17 LEU LEU A . n A 1 17 THR 17 18 18 THR THR A . n A 1 18 GLY 18 19 19 GLY GLY A . n A 1 19 SER 19 20 20 SER SER A . n A 1 20 ASP 20 21 21 ASP ASP A . n A 1 21 ASP 21 22 22 ASP ASP A . n A 1 22 VAL 22 23 23 VAL VAL A . n A 1 23 LYS 23 24 24 LYS LYS A . n A 1 24 LYS 24 25 25 LYS LYS A . n A 1 25 ASN 25 26 26 ASN ASN A . n A 1 26 LEU 26 27 27 LEU LEU A . n A 1 27 ASP 27 28 28 ASP ASP A . n A 1 28 LEU 28 29 29 LEU LEU A . n A 1 29 ASN 29 30 30 ASN ASN A . n A 1 30 LEU 30 31 31 LEU LEU A . n A 1 31 PHE 31 32 32 PHE PHE A . n A 1 32 GLU 32 33 33 GLU GLU A . n A 1 33 THR 33 34 34 THR THR A . n A 1 34 GLY 34 35 35 GLY GLY A . n A 1 35 LEU 35 36 36 LEU LEU A . n A 1 36 LEU 36 37 37 LEU LEU A . n A 1 37 ASP 37 38 38 ASP ASP A . n A 1 38 SER 38 39 39 SER SER A . n A 1 39 MET 39 40 40 MET MET A . n A 1 40 GLY 40 41 41 GLY GLY A . n A 1 41 THR 41 42 42 THR THR A . n A 1 42 VAL 42 43 43 VAL VAL A . n A 1 43 GLN 43 44 44 GLN GLN A . n A 1 44 LEU 44 45 45 LEU LEU A . n A 1 45 LEU 45 46 46 LEU LEU A . n A 1 46 LEU 46 47 47 LEU LEU A . n A 1 47 GLU 47 48 48 GLU GLU A . n A 1 48 LEU 48 49 49 LEU LEU A . n A 1 49 GLN 49 50 50 GLN GLN A . n A 1 50 SER 50 51 51 SER SER A . n A 1 51 GLN 51 52 52 GLN GLN A . n A 1 52 PHE 52 53 53 PHE PHE A . n A 1 53 GLY 53 54 54 GLY GLY A . n A 1 54 VAL 54 55 55 VAL VAL A . n A 1 55 ASP 55 56 56 ASP ASP A . n A 1 56 ALA 56 57 57 ALA ALA A . n A 1 57 PRO 57 58 58 PRO PRO A . n A 1 58 VAL 58 59 59 VAL VAL A . n A 1 59 SER 59 60 60 SER SER A . n A 1 60 GLU 60 61 61 GLU GLU A . n A 1 61 PHE 61 62 62 PHE PHE A . n A 1 62 ASP 62 63 63 ASP ASP A . n A 1 63 ARG 63 64 64 ARG ARG A . n A 1 64 LYS 64 65 65 LYS LYS A . n A 1 65 GLU 65 66 66 GLU GLU A . n A 1 66 TRP 66 67 67 TRP TRP A . n A 1 67 ASP 67 68 68 ASP ASP A . n A 1 68 THR 68 69 69 THR THR A . n A 1 69 PRO 69 70 70 PRO PRO A . n A 1 70 ASN 70 71 71 ASN ASN A . n A 1 71 LYS 71 72 72 LYS LYS A . n A 1 72 ILE 72 73 73 ILE ILE A . n A 1 73 ILE 73 74 74 ILE ILE A . n A 1 74 ALA 74 75 75 ALA ALA A . n A 1 75 LYS 75 76 76 LYS LYS A . n A 1 76 VAL 76 77 77 VAL VAL A . n A 1 77 GLU 77 78 78 GLU GLU A . n A 1 78 GLN 78 79 79 GLN GLN A . n A 1 79 ALA 79 80 80 ALA ALA A . n A 1 80 GLN 80 81 81 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-08-01 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A LEU 31 ? ? O A ASP 68 ? ? 1.47 2 1 O A LEU 49 ? ? H A VAL 55 ? ? 1.50 3 1 O A ASP 63 ? ? H A GLU 66 ? ? 1.50 4 1 O A ASN 8 ? ? H A ASP 12 ? ? 1.51 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 21 ? ? -91.95 37.25 2 1 LYS A 25 ? ? -111.63 -75.24 3 1 ASP A 28 ? ? -155.49 33.97 4 1 ASP A 38 ? ? -130.00 -60.98 5 1 SER A 39 ? ? -179.42 -53.16 6 1 SER A 51 ? ? -124.04 -58.79 7 1 VAL A 59 ? ? -136.70 -45.55 8 1 SER A 60 ? ? -36.10 -35.05 9 1 GLU A 61 ? ? 178.39 66.90 #