data_1HSQ # _entry.id 1HSQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1HSQ WWPDB D_1000174001 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2HSP _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HSQ _pdbx_database_status.recvd_initial_deposition_date 1994-06-13 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kohda, D.' 1 'Hatanaka, H.' 2 'Odaka, M.' 3 'Inagaki, F.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of the SH3 domain of phospholipase C-gamma.' 'Cell(Cambridge,Mass.)' 72 953 960 1993 CELLB5 US 0092-8674 0998 ? 7681365 '10.1016/0092-8674(93)90583-C' 1 'Solution Structure and Ligand-Binding Site of the C-Terminal SH3 Domain of Grb2' Structure 2 1029 1040 1994 STRUE6 UK 0969-2126 2005 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kohda, D.' 1 primary 'Hatanaka, H.' 2 primary 'Odaka, M.' 3 primary 'Mandiyan, V.' 4 primary 'Ullrich, A.' 5 primary 'Schlessinger, J.' 6 primary 'Inagaki, F.' 7 1 'Kohda, D.' 8 1 'Terasawa, H.' 9 1 'Ichikawa, S.' 10 1 'Ogura, K.' 11 1 'Hatanaka, H.' 12 1 'Mandiyan, V.' 13 1 'Ullrich, A.' 14 1 'Schlessinger, J.' 15 1 'Inagaki, F.' 16 # _cell.entry_id 1HSQ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HSQ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PHOSPHOLIPASE C-GAMMA (SH3 DOMAIN)' _entity.formula_weight 8249.244 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.4.11 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVNPEGIHRD _entity_poly.pdbx_seq_one_letter_code_can GSPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVNPEGIHRD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 THR n 1 5 PHE n 1 6 LYS n 1 7 CYS n 1 8 ALA n 1 9 VAL n 1 10 LYS n 1 11 ALA n 1 12 LEU n 1 13 PHE n 1 14 ASP n 1 15 TYR n 1 16 LYS n 1 17 ALA n 1 18 GLN n 1 19 ARG n 1 20 GLU n 1 21 ASP n 1 22 GLU n 1 23 LEU n 1 24 THR n 1 25 PHE n 1 26 ILE n 1 27 LYS n 1 28 SER n 1 29 ALA n 1 30 ILE n 1 31 ILE n 1 32 GLN n 1 33 ASN n 1 34 VAL n 1 35 GLU n 1 36 LYS n 1 37 GLN n 1 38 GLU n 1 39 GLY n 1 40 GLY n 1 41 TRP n 1 42 TRP n 1 43 ARG n 1 44 GLY n 1 45 ASP n 1 46 TYR n 1 47 GLY n 1 48 GLY n 1 49 LYS n 1 50 LYS n 1 51 GLN n 1 52 LEU n 1 53 TRP n 1 54 PHE n 1 55 PRO n 1 56 SER n 1 57 ASN n 1 58 TYR n 1 59 VAL n 1 60 GLU n 1 61 GLU n 1 62 MET n 1 63 VAL n 1 64 ASN n 1 65 PRO n 1 66 GLU n 1 67 GLY n 1 68 ILE n 1 69 HIS n 1 70 ARG n 1 71 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene GRB2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PLCG1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P19174 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIEGAIDIREIKE IRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQ FYSVDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVTFLFSKENSVWNSQLDAVCPD TMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEH AFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRD GRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQ QVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALF DYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPA CQIAIRPEGKNNRLFVFSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNF QTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAE YDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL ELASLLIKIDIFPAKENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPR RTRVNGDNRL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HSQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19174 _struct_ref_seq.db_align_beg 790 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 851 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1HSQ _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DSPACE ? NILGES 1 refinement X-PLOR ? BRUNGER 2 # _exptl.entry_id 1HSQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1HSQ _struct.title 'SOLUTION STRUCTURE OF THE SH3 DOMAIN OF PHOSPHOLIPASE CGAMMA' _struct.pdbx_descriptor 'PHOSPHOLIPASE C-GAMMA (SH3 DOMAIN) (E.C.3.1.4.11) (NMR, MINIMIZED MEAN STRUCTURE)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HSQ _struct_keywords.pdbx_keywords 'PHOSPHORIC DIESTER HYDROLASE' _struct_keywords.text 'PHOSPHORIC DIESTER HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id GH _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 56 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 58 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 56 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 58 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details '3/10 HELIX' _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details B1 ? 3 ? B2 ? 2 ? B3A ? 3 ? B3B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense B1 1 2 ? anti-parallel B1 2 3 ? anti-parallel B2 1 2 ? anti-parallel B3A 1 2 ? anti-parallel B3A 2 3 ? anti-parallel B3B 1 2 ? anti-parallel B3B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id B1 1 ALA A 29 ? GLN A 32 ? ALA A 29 GLN A 32 B1 2 CYS A 7 ? ALA A 11 ? CYS A 7 ALA A 11 B1 3 VAL A 59 ? MET A 62 ? VAL A 59 MET A 62 B2 1 PHE A 13 ? LYS A 16 ? PHE A 13 LYS A 16 B2 2 THR A 24 ? ILE A 26 ? THR A 24 ILE A 26 B3A 1 VAL A 34 ? LYS A 36 ? VAL A 34 LYS A 36 B3A 2 TRP A 41 ? TYR A 46 ? TRP A 41 TYR A 46 B3A 3 LYS A 49 ? LYS A 50 ? LYS A 49 LYS A 50 B3B 1 VAL A 34 ? LYS A 36 ? VAL A 34 LYS A 36 B3B 2 TRP A 41 ? TYR A 46 ? TRP A 41 TYR A 46 B3B 3 LEU A 52 ? PRO A 55 ? LEU A 52 PRO A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id B1 1 2 N ILE A 31 ? N ILE A 31 O VAL A 9 ? O VAL A 9 B1 2 3 N LYS A 10 ? N LYS A 10 O GLU A 60 ? O GLU A 60 B2 1 2 N TYR A 15 ? N TYR A 15 O PHE A 25 ? O PHE A 25 B3A 1 2 N GLU A 35 ? N GLU A 35 O ARG A 43 ? O ARG A 43 B3A 2 3 N TYR A 46 ? N TYR A 46 O LYS A 49 ? O LYS A 49 B3B 1 2 N GLU A 35 ? N GLU A 35 O ARG A 43 ? O ARG A 43 B3B 2 3 N TRP A 42 ? N TRP A 42 O PHE A 54 ? O PHE A 54 # _database_PDB_matrix.entry_id 1HSQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HSQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'A BETA-BULGE STRUCTURE OCCURS AT LYS 50 - GLN 51 - LEU 52.' # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ASP 71 71 71 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-08-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A TRP 42 ? ? CD2 A TRP 42 ? ? 1.325 1.432 -0.107 0.017 N 2 1 CG A TRP 53 ? ? CD2 A TRP 53 ? ? 1.327 1.432 -0.105 0.017 N 3 1 CG A HIS 69 ? ? ND1 A HIS 69 ? ? 1.267 1.369 -0.102 0.015 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A TRP 41 ? ? CD1 A TRP 41 ? ? NE1 A TRP 41 ? ? 104.05 110.10 -6.05 1.00 N 2 1 CD1 A TRP 41 ? ? NE1 A TRP 41 ? ? CE2 A TRP 41 ? ? 115.27 109.00 6.27 0.90 N 3 1 NE1 A TRP 41 ? ? CE2 A TRP 41 ? ? CZ2 A TRP 41 ? ? 138.89 130.40 8.49 1.10 N 4 1 NE1 A TRP 41 ? ? CE2 A TRP 41 ? ? CD2 A TRP 41 ? ? 100.80 107.30 -6.50 1.00 N 5 1 CG A TRP 42 ? ? CD1 A TRP 42 ? ? NE1 A TRP 42 ? ? 102.93 110.10 -7.17 1.00 N 6 1 CD1 A TRP 42 ? ? NE1 A TRP 42 ? ? CE2 A TRP 42 ? ? 115.83 109.00 6.83 0.90 N 7 1 NE1 A TRP 42 ? ? CE2 A TRP 42 ? ? CZ2 A TRP 42 ? ? 137.41 130.40 7.01 1.10 N 8 1 CG A TRP 53 ? ? CD1 A TRP 53 ? ? NE1 A TRP 53 ? ? 103.16 110.10 -6.94 1.00 N 9 1 CD1 A TRP 53 ? ? NE1 A TRP 53 ? ? CE2 A TRP 53 ? ? 115.15 109.00 6.15 0.90 N 10 1 NE1 A TRP 53 ? ? CE2 A TRP 53 ? ? CZ2 A TRP 53 ? ? 139.64 130.40 9.24 1.10 N 11 1 NE1 A TRP 53 ? ? CE2 A TRP 53 ? ? CD2 A TRP 53 ? ? 100.70 107.30 -6.60 1.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -159.76 68.20 2 1 PHE A 5 ? ? -77.21 -162.09 3 1 LYS A 6 ? ? 53.54 167.74 4 1 ALA A 11 ? ? -34.85 115.83 5 1 LYS A 16 ? ? -149.31 58.68 6 1 GLN A 18 ? ? 71.46 -36.96 7 1 ARG A 19 ? ? -173.06 76.84 8 1 GLU A 20 ? ? -153.02 46.89 9 1 GLU A 22 ? ? 175.36 153.00 10 1 SER A 28 ? ? 105.16 -12.11 11 1 ASN A 33 ? ? 55.59 96.23 12 1 GLU A 35 ? ? -179.15 106.52 13 1 LYS A 36 ? ? -43.80 158.71 14 1 GLU A 38 ? ? 46.68 16.11 15 1 TYR A 46 ? ? -169.45 45.98 16 1 GLN A 51 ? ? 75.56 80.14 17 1 LEU A 52 ? ? -104.67 -115.06 18 1 GLU A 60 ? ? -173.09 131.76 19 1 GLU A 61 ? ? -59.57 74.59 20 1 MET A 62 ? ? 33.82 101.59 21 1 VAL A 63 ? ? -73.37 27.10 22 1 PRO A 65 ? ? -59.01 -145.04 23 1 GLU A 66 ? ? 58.60 143.89 24 1 ARG A 70 ? ? -73.68 -132.77 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 19 ? ? 0.142 'SIDE CHAIN' 2 1 ARG A 43 ? ? 0.186 'SIDE CHAIN' 3 1 ARG A 70 ? ? 0.277 'SIDE CHAIN' #