data_1IL6 # _entry.id 1IL6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IL6 pdb_00001il6 10.2210/pdb1il6/pdb WWPDB D_1000174177 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2IL6 _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IL6 _pdbx_database_status.recvd_initial_deposition_date 1997-01-31 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, G.Y.' 1 'Yu, H.A.' 2 'Hong, J.' 3 'Stahl, M.' 4 'Mcdonagh, T.' 5 'Kay, L.E.' 6 'Cumming, D.A.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of recombinant human interleukin-6.' J.Mol.Biol. 268 468 481 1997 JMOBAK UK 0022-2836 0070 ? 9159484 10.1006/jmbi.1997.0933 1 'Complete 1H, 15N and 13C Assignments, Secondary Structure, and Topology of Recombinant Human Interleukin-6' J.Biomol.NMR 8 123 ? 1996 JBNME9 NE 0925-2738 0800 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, G.Y.' 1 ? primary 'Yu, H.A.' 2 ? primary 'Hong, J.' 3 ? primary 'Stahl, M.' 4 ? primary 'McDonagh, T.' 5 ? primary 'Kay, L.E.' 6 ? primary 'Cumming, D.A.' 7 ? 1 'Xu, G.Y.' 8 ? 1 'Hong, J.' 9 ? 1 'Mcdonagh, T.' 10 ? 1 'Stahl, M.' 11 ? 1 'Kay, L.E.' 12 ? 1 'Seehra, J.' 13 ? 1 'Cumming, D.A.' 14 ? # _cell.entry_id 1IL6 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1IL6 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description INTERLEUKIN-6 _entity.formula_weight 21005.961 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFN EETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQ DMTTHLILRSFKEFLQSSLRALRQM ; _entity_poly.pdbx_seq_one_letter_code_can ;APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFN EETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQ DMTTHLILRSFKEFLQSSLRALRQM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 VAL n 1 4 PRO n 1 5 PRO n 1 6 GLY n 1 7 GLU n 1 8 ASP n 1 9 SER n 1 10 LYS n 1 11 ASP n 1 12 VAL n 1 13 ALA n 1 14 ALA n 1 15 PRO n 1 16 HIS n 1 17 ARG n 1 18 GLN n 1 19 PRO n 1 20 LEU n 1 21 THR n 1 22 SER n 1 23 SER n 1 24 GLU n 1 25 ARG n 1 26 ILE n 1 27 ASP n 1 28 LYS n 1 29 GLN n 1 30 ILE n 1 31 ARG n 1 32 TYR n 1 33 ILE n 1 34 LEU n 1 35 ASP n 1 36 GLY n 1 37 ILE n 1 38 SER n 1 39 ALA n 1 40 LEU n 1 41 ARG n 1 42 LYS n 1 43 GLU n 1 44 THR n 1 45 CYS n 1 46 ASN n 1 47 LYS n 1 48 SER n 1 49 ASN n 1 50 MET n 1 51 CYS n 1 52 GLU n 1 53 SER n 1 54 SER n 1 55 LYS n 1 56 GLU n 1 57 ALA n 1 58 LEU n 1 59 ALA n 1 60 GLU n 1 61 ASN n 1 62 ASN n 1 63 LEU n 1 64 ASN n 1 65 LEU n 1 66 PRO n 1 67 LYS n 1 68 MET n 1 69 ALA n 1 70 GLU n 1 71 LYS n 1 72 ASP n 1 73 GLY n 1 74 CYS n 1 75 PHE n 1 76 GLN n 1 77 SER n 1 78 GLY n 1 79 PHE n 1 80 ASN n 1 81 GLU n 1 82 GLU n 1 83 THR n 1 84 CYS n 1 85 LEU n 1 86 VAL n 1 87 LYS n 1 88 ILE n 1 89 ILE n 1 90 THR n 1 91 GLY n 1 92 LEU n 1 93 LEU n 1 94 GLU n 1 95 PHE n 1 96 GLU n 1 97 VAL n 1 98 TYR n 1 99 LEU n 1 100 GLU n 1 101 TYR n 1 102 LEU n 1 103 GLN n 1 104 ASN n 1 105 ARG n 1 106 PHE n 1 107 GLU n 1 108 SER n 1 109 SER n 1 110 GLU n 1 111 GLU n 1 112 GLN n 1 113 ALA n 1 114 ARG n 1 115 ALA n 1 116 VAL n 1 117 GLN n 1 118 MET n 1 119 SER n 1 120 THR n 1 121 LYS n 1 122 VAL n 1 123 LEU n 1 124 ILE n 1 125 GLN n 1 126 PHE n 1 127 LEU n 1 128 GLN n 1 129 LYS n 1 130 LYS n 1 131 ALA n 1 132 LYS n 1 133 ASN n 1 134 LEU n 1 135 ASP n 1 136 ALA n 1 137 ILE n 1 138 THR n 1 139 THR n 1 140 PRO n 1 141 ASP n 1 142 PRO n 1 143 THR n 1 144 THR n 1 145 ASN n 1 146 ALA n 1 147 SER n 1 148 LEU n 1 149 LEU n 1 150 THR n 1 151 LYS n 1 152 LEU n 1 153 GLN n 1 154 ALA n 1 155 GLN n 1 156 ASN n 1 157 GLN n 1 158 TRP n 1 159 LEU n 1 160 GLN n 1 161 ASP n 1 162 MET n 1 163 THR n 1 164 THR n 1 165 HIS n 1 166 LEU n 1 167 ILE n 1 168 LEU n 1 169 ARG n 1 170 SER n 1 171 PHE n 1 172 LYS n 1 173 GLU n 1 174 PHE n 1 175 LEU n 1 176 GLN n 1 177 SER n 1 178 SER n 1 179 LEU n 1 180 ARG n 1 181 ALA n 1 182 LEU n 1 183 ARG n 1 184 GLN n 1 185 MET n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name human _entity_src_nat.pdbx_organism_scientific 'Homo sapiens' _entity_src_nat.pdbx_ncbi_taxonomy_id 9606 _entity_src_nat.genus Homo _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IL6_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P05231 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCES SKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKN LDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IL6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 185 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05231 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 212 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 185 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2/3/4D NOESY' 1 2 1 TOCSY 1 3 1 ETC. 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'UNITY PLUS 600' _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1IL6 _pdbx_nmr_refine.method 'DISTANCE GEOMETRY AND SIMULATED ANNEALING.' _pdbx_nmr_refine.details ;STRUCTURES ARE BASED ON 2961 INTERPROTON DISTANCE RESTRAINTS DERIVED FROM NMR MEASUREMENTS INCLUDING 138 HYDROGEN BOND RESTRAINTS FROM 69 HYDROGEN BONDS IDENTIFIED USING AMIDE EXCHANGE DATA AND INITIAL STRUCTURE CALCULATIONS. IN ADDITION, 83 PHI BACKBONE TORSION ANGLE RESTRAINTS WERE DERIVED FROM COUPLING CONSTANTS. THE METHOD USED TO DERIVE THE FINAL ENSEMBLE OF STRUCTURES IS THE HYBRID METRIC MATRIX DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING METHOD (M. NILGES, G.M. CLORE, AND A.M. GRONENBORN (1988) FEBS LETT. 229, 317-324. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1IL6 _pdbx_nmr_ensemble.conformers_calculated_total_number 75 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 1IL6 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1IL6 _struct.title 'HUMAN INTERLEUKIN-6, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IL6 _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text 'CYTOKINE, GLYCOPROTEIN, GROWTH FACTOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 22 ? ARG A 41 ? SER A 22 ARG A 41 1 ? 20 HELX_P HELX_P2 2 GLU A 43 ? ASN A 46 ? GLU A 43 ASN A 46 1 ? 4 HELX_P HELX_P3 3 GLU A 82 ? ASN A 104 ? GLU A 82 ASN A 104 1 ? 23 HELX_P HELX_P4 4 GLU A 110 ? LYS A 130 ? GLU A 110 LYS A 130 1 ? 21 HELX_P HELX_P5 5 PRO A 142 ? GLN A 153 ? PRO A 142 GLN A 153 1 ? 12 HELX_P HELX_P6 6 GLN A 157 ? ARG A 183 ? GLN A 157 ARG A 183 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 45 A CYS 51 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf2 disulf ? ? A CYS 74 SG ? ? ? 1_555 A CYS 84 SG ? ? A CYS 74 A CYS 84 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1IL6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IL6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 VAL 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 ASP 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 ASP 11 11 ? ? ? A . n A 1 12 VAL 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 PRO 15 15 ? ? ? A . n A 1 16 HIS 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 GLN 18 18 ? ? ? A . n A 1 19 PRO 19 19 ? ? ? A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 TRP 158 158 158 TRP TRP A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 MET 162 162 162 MET MET A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 MET 185 185 185 MET MET A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-02-04 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 44 ? ? -86.35 41.79 2 1 CYS A 45 ? ? -149.28 -47.87 3 1 LYS A 47 ? ? -92.90 30.24 4 1 ASN A 49 ? ? 47.82 19.80 5 1 MET A 50 ? ? -152.26 39.36 6 1 CYS A 51 ? ? -155.33 -60.29 7 1 GLU A 52 ? ? -163.23 44.31 8 1 SER A 53 ? ? -49.03 -73.56 9 1 SER A 54 ? ? -172.83 33.64 10 1 LYS A 55 ? ? -157.87 -50.93 11 1 GLU A 56 ? ? 177.72 -69.58 12 1 ALA A 57 ? ? 77.44 82.57 13 1 LEU A 58 ? ? -58.58 95.61 14 1 ASN A 62 ? ? 63.76 93.63 15 1 LEU A 63 ? ? -57.61 -168.53 16 1 LYS A 67 ? ? 175.48 54.77 17 1 MET A 68 ? ? -174.60 138.87 18 1 ALA A 69 ? ? -177.92 -163.16 19 1 SER A 77 ? ? -55.64 104.29 20 1 PHE A 79 ? ? -63.88 98.09 21 1 GLU A 81 ? ? -141.46 -56.08 22 1 LEU A 134 ? ? -136.03 -150.89 23 1 ALA A 136 ? ? 84.19 -19.84 24 1 ILE A 137 ? ? 59.33 17.09 25 1 THR A 138 ? ? 48.97 -154.93 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 25 ? ? 0.257 'SIDE CHAIN' 2 1 ARG A 31 ? ? 0.187 'SIDE CHAIN' 3 1 ARG A 41 ? ? 0.236 'SIDE CHAIN' 4 1 ARG A 105 ? ? 0.297 'SIDE CHAIN' 5 1 ARG A 114 ? ? 0.179 'SIDE CHAIN' 6 1 ARG A 169 ? ? 0.157 'SIDE CHAIN' 7 1 ARG A 180 ? ? 0.282 'SIDE CHAIN' 8 1 ARG A 183 ? ? 0.253 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A VAL 3 ? A VAL 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A ASP 8 ? A ASP 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A ASP 11 ? A ASP 11 12 1 Y 1 A VAL 12 ? A VAL 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A PRO 15 ? A PRO 15 16 1 Y 1 A HIS 16 ? A HIS 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A GLN 18 ? A GLN 18 19 1 Y 1 A PRO 19 ? A PRO 19 #