data_1INR # _entry.id 1INR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1INR WWPDB D_1000174215 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1INR _pdbx_database_status.recvd_initial_deposition_date 1995-07-31 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # _audit_author.name 'Walter, M.R.' _audit_author.pdbx_ordinal 1 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structure of interleukin 10 reveals an interferon gamma-like fold.' Biochemistry 34 12118 12125 1995 BICHAW US 0006-2960 0033 ? 7547951 10.1021/bi00038a004 1 'Crystallization and Preliminary X-Ray Investigation of Human Interleukin-10' Proteins 22 187 ? 1995 PSFGEY US 0887-3585 0867 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Walter, M.R.' 1 primary 'Nagabhushan, T.L.' 2 1 'Cook, W.J.' 3 1 'Windsor, W.T.' 4 1 'Murgola, N.J.' 5 1 'Tindall, S.H.' 6 1 'Nagabhushan, T.L.' 7 1 'Walter, M.R.' 8 # _cell.entry_id 1INR _cell.length_a 36.370 _cell.length_b 36.370 _cell.length_c 220.970 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1INR _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man INTERLEUKIN-10 18672.447 1 ? ? ? ? 2 water nat water 18.015 42 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CYTOKINE SYNTHESIS INHIBITORY FACTOR, CSIF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQA ENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN ; _entity_poly.pdbx_seq_one_letter_code_can ;SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQA ENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 PRO n 1 3 GLY n 1 4 GLN n 1 5 GLY n 1 6 THR n 1 7 GLN n 1 8 SER n 1 9 GLU n 1 10 ASN n 1 11 SER n 1 12 CYS n 1 13 THR n 1 14 HIS n 1 15 PHE n 1 16 PRO n 1 17 GLY n 1 18 ASN n 1 19 LEU n 1 20 PRO n 1 21 ASN n 1 22 MET n 1 23 LEU n 1 24 ARG n 1 25 ASP n 1 26 LEU n 1 27 ARG n 1 28 ASP n 1 29 ALA n 1 30 PHE n 1 31 SER n 1 32 ARG n 1 33 VAL n 1 34 LYS n 1 35 THR n 1 36 PHE n 1 37 PHE n 1 38 GLN n 1 39 MET n 1 40 LYS n 1 41 ASP n 1 42 GLN n 1 43 LEU n 1 44 ASP n 1 45 ASN n 1 46 LEU n 1 47 LEU n 1 48 LEU n 1 49 LYS n 1 50 GLU n 1 51 SER n 1 52 LEU n 1 53 LEU n 1 54 GLU n 1 55 ASP n 1 56 PHE n 1 57 LYS n 1 58 GLY n 1 59 TYR n 1 60 LEU n 1 61 GLY n 1 62 CYS n 1 63 GLN n 1 64 ALA n 1 65 LEU n 1 66 SER n 1 67 GLU n 1 68 MET n 1 69 ILE n 1 70 GLN n 1 71 PHE n 1 72 TYR n 1 73 LEU n 1 74 GLU n 1 75 GLU n 1 76 VAL n 1 77 MET n 1 78 PRO n 1 79 GLN n 1 80 ALA n 1 81 GLU n 1 82 ASN n 1 83 GLN n 1 84 ASP n 1 85 PRO n 1 86 ASP n 1 87 ILE n 1 88 LYS n 1 89 ALA n 1 90 HIS n 1 91 VAL n 1 92 ASN n 1 93 SER n 1 94 LEU n 1 95 GLY n 1 96 GLU n 1 97 ASN n 1 98 LEU n 1 99 LYS n 1 100 THR n 1 101 LEU n 1 102 ARG n 1 103 LEU n 1 104 ARG n 1 105 LEU n 1 106 ARG n 1 107 ARG n 1 108 CYS n 1 109 HIS n 1 110 ARG n 1 111 PHE n 1 112 LEU n 1 113 PRO n 1 114 CYS n 1 115 GLU n 1 116 ASN n 1 117 LYS n 1 118 SER n 1 119 LYS n 1 120 ALA n 1 121 VAL n 1 122 GLU n 1 123 GLN n 1 124 VAL n 1 125 LYS n 1 126 ASN n 1 127 ALA n 1 128 PHE n 1 129 ASN n 1 130 LYS n 1 131 LEU n 1 132 GLN n 1 133 GLU n 1 134 LYS n 1 135 GLY n 1 136 ILE n 1 137 TYR n 1 138 LYS n 1 139 ALA n 1 140 MET n 1 141 SER n 1 142 GLU n 1 143 PHE n 1 144 ASP n 1 145 ILE n 1 146 PHE n 1 147 ILE n 1 148 ASN n 1 149 TYR n 1 150 ILE n 1 151 GLU n 1 152 ALA n 1 153 TYR n 1 154 MET n 1 155 THR n 1 156 MET n 1 157 LYS n 1 158 ILE n 1 159 ARG n 1 160 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IL10_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P22301 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGC QALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSE FDIFINYIEAYMTMKIRN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1INR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 160 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22301 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 178 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 160 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1INR _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.96 _exptl_crystal.density_percent_sol 38. _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1994-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.87 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE BW7B' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, Hamburg' _diffrn_source.pdbx_synchrotron_beamline BW7B _diffrn_source.pdbx_wavelength 0.87 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1INR _reflns.observed_criterion_sigma_I 0. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20. _reflns.d_resolution_high 2.0 _reflns.number_obs 10087 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.2 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 1INR _refine.ls_number_reflns_obs 9888 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10. _refine.ls_d_res_high 2. _refine.ls_percent_reflns_obs 83. _refine.ls_R_factor_obs 0.221 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.221 _refine.ls_R_factor_R_free 0.337 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10. _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 31.7 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1072 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 1114 _refine_hist.d_res_high 2. _refine_hist.d_res_low 10. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.02 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 3.79 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 21.84 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.57 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1INR _struct.title 'CYTOKINE SYNTHESIS' _struct.pdbx_descriptor INTERLEUKIN-10 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1INR _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text CYTOKINE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 18 ? PHE A 37 ? ASN A 18 PHE A 37 1 ? 20 HELX_P HELX_P2 2 GLU A 50 ? PHE A 56 ? GLU A 50 PHE A 56 1 ? 7 HELX_P HELX_P3 3 GLY A 61 ? GLU A 74 ? GLY A 61 GLU A 74 1 ? 14 HELX_P HELX_P4 4 VAL A 76 ? GLN A 83 ? VAL A 76 GLN A 83 1 ? 8 HELX_P HELX_P5 5 LYS A 88 ? ARG A 106 ? LYS A 88 ARG A 106 5 ? 19 HELX_P HELX_P6 6 PRO A 113 ? GLU A 115 ? PRO A 113 GLU A 115 5 ? 3 HELX_P HELX_P7 7 LYS A 119 ? LEU A 131 ? LYS A 119 LEU A 131 1 ? 13 HELX_P HELX_P8 8 LYS A 134 ? SER A 141 ? LYS A 134 SER A 141 5 ? 8 HELX_P HELX_P9 9 PHE A 143 ? MET A 156 ? PHE A 143 MET A 156 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 62 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 114 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 62 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 114 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.938 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1INR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1INR _atom_sites.fract_transf_matrix[1][1] 0.027495 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027495 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004526 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 THR 6 6 ? ? ? A . n A 1 7 GLN 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 GLU 9 9 ? ? ? A . n A 1 10 ASN 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 CYS 12 12 ? ? ? A . n A 1 13 THR 13 13 ? ? ? A . n A 1 14 HIS 14 14 ? ? ? A . n A 1 15 PHE 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 GLN 38 38 ? ? ? A . n A 1 39 MET 39 39 ? ? ? A . n A 1 40 LYS 40 40 ? ? ? A . n A 1 41 ASP 41 41 ? ? ? A . n A 1 42 GLN 42 42 ? ? ? A . n A 1 43 LEU 43 43 ? ? ? A . n A 1 44 ASP 44 44 ? ? ? A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 CYS 108 108 ? ? ? A . n A 1 109 HIS 109 109 ? ? ? A . n A 1 110 ARG 110 110 ? ? ? A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 CYS 114 114 114 CYS CYS A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 TYR 149 149 149 TYR TYR A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 MET 154 154 154 MET MET A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 MET 156 156 156 MET MET A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 ASN 160 160 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8170 ? 1 MORE -82 ? 1 'SSA (A^2)' 13530 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-10-14 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 X-PLOR 'model building' 3.1 ? 3 X-PLOR refinement 3.1 ? 4 X-PLOR phasing 3.1 ? 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH2 A ARG 24 ? ? 114.51 120.30 -5.79 0.50 N 2 1 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 125.40 120.30 5.10 0.50 N 3 1 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH2 A ARG 27 ? ? 111.70 120.30 -8.60 0.50 N 4 1 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.91 120.30 3.61 0.50 N 5 1 CA A LYS 34 ? ? CB A LYS 34 ? ? CG A LYS 34 ? ? 128.82 113.40 15.42 2.20 N 6 1 CA A LEU 46 ? ? CB A LEU 46 ? ? CG A LEU 46 ? ? 131.88 115.30 16.58 2.30 N 7 1 CA A GLU 54 ? ? CB A GLU 54 ? ? CG A GLU 54 ? ? 96.43 113.40 -16.97 2.20 N 8 1 N A GLU 81 ? ? CA A GLU 81 ? ? CB A GLU 81 ? ? 99.52 110.60 -11.08 1.80 N 9 1 CA A GLU 81 ? ? CB A GLU 81 ? ? CG A GLU 81 ? ? 133.29 113.40 19.89 2.20 N 10 1 CG1 A VAL 91 ? ? CB A VAL 91 ? ? CG2 A VAL 91 ? ? 96.21 110.90 -14.69 1.60 N 11 1 CA A ARG 102 ? ? CB A ARG 102 ? ? CG A ARG 102 ? ? 96.39 113.40 -17.01 2.20 N 12 1 NE A ARG 102 ? ? CZ A ARG 102 ? ? NH1 A ARG 102 ? ? 127.07 120.30 6.77 0.50 N 13 1 NE A ARG 102 ? ? CZ A ARG 102 ? ? NH2 A ARG 102 ? ? 111.73 120.30 -8.57 0.50 N 14 1 CB A TYR 137 ? ? CG A TYR 137 ? ? CD1 A TYR 137 ? ? 114.65 121.00 -6.35 0.60 N 15 1 CB A ASP 144 ? ? CG A ASP 144 ? ? OD1 A ASP 144 ? ? 123.98 118.30 5.68 0.90 N 16 1 CG1 A ILE 145 ? ? CB A ILE 145 ? ? CG2 A ILE 145 ? ? 96.68 111.40 -14.72 2.20 N 17 1 CA A MET 154 ? ? CB A MET 154 ? ? CG A MET 154 ? ? 125.76 113.30 12.46 1.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 75 ? ? -103.45 -63.56 2 1 GLN A 132 ? ? 56.56 -131.27 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 18 ? CG ? A ASN 18 CG 2 1 Y 1 A ASN 18 ? OD1 ? A ASN 18 OD1 3 1 Y 1 A ASN 18 ? ND2 ? A ASN 18 ND2 4 1 Y 1 A ASN 21 ? CG ? A ASN 21 CG 5 1 Y 1 A ASN 21 ? OD1 ? A ASN 21 OD1 6 1 Y 1 A ASN 21 ? ND2 ? A ASN 21 ND2 7 1 Y 1 A TYR 59 ? CG ? A TYR 59 CG 8 1 Y 1 A TYR 59 ? CD1 ? A TYR 59 CD1 9 1 Y 1 A TYR 59 ? CD2 ? A TYR 59 CD2 10 1 Y 1 A TYR 59 ? CE1 ? A TYR 59 CE1 11 1 Y 1 A TYR 59 ? CE2 ? A TYR 59 CE2 12 1 Y 1 A TYR 59 ? CZ ? A TYR 59 CZ 13 1 Y 1 A TYR 59 ? OH ? A TYR 59 OH 14 1 Y 1 A ARG 107 ? CG ? A ARG 107 CG 15 1 Y 1 A ARG 107 ? CD ? A ARG 107 CD 16 1 Y 1 A ARG 107 ? NE ? A ARG 107 NE 17 1 Y 1 A ARG 107 ? CZ ? A ARG 107 CZ 18 1 Y 1 A ARG 107 ? NH1 ? A ARG 107 NH1 19 1 Y 1 A ARG 107 ? NH2 ? A ARG 107 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A THR 6 ? A THR 6 7 1 Y 1 A GLN 7 ? A GLN 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A GLU 9 ? A GLU 9 10 1 Y 1 A ASN 10 ? A ASN 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A CYS 12 ? A CYS 12 13 1 Y 1 A THR 13 ? A THR 13 14 1 Y 1 A HIS 14 ? A HIS 14 15 1 Y 1 A PHE 15 ? A PHE 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A GLN 38 ? A GLN 38 19 1 Y 1 A MET 39 ? A MET 39 20 1 Y 1 A LYS 40 ? A LYS 40 21 1 Y 1 A ASP 41 ? A ASP 41 22 1 Y 1 A GLN 42 ? A GLN 42 23 1 Y 1 A LEU 43 ? A LEU 43 24 1 Y 1 A ASP 44 ? A ASP 44 25 1 Y 1 A CYS 108 ? A CYS 108 26 1 Y 1 A HIS 109 ? A HIS 109 27 1 Y 1 A ARG 110 ? A ARG 110 28 1 Y 1 A ASN 160 ? A ASN 160 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 161 160 HOH HOH A . B 2 HOH 2 162 161 HOH HOH A . B 2 HOH 3 163 162 HOH HOH A . B 2 HOH 4 164 163 HOH HOH A . B 2 HOH 5 165 164 HOH HOH A . B 2 HOH 6 166 165 HOH HOH A . B 2 HOH 7 167 166 HOH HOH A . B 2 HOH 8 168 167 HOH HOH A . B 2 HOH 9 169 168 HOH HOH A . B 2 HOH 10 170 169 HOH HOH A . B 2 HOH 11 171 170 HOH HOH A . B 2 HOH 12 172 171 HOH HOH A . B 2 HOH 13 173 172 HOH HOH A . B 2 HOH 14 174 173 HOH HOH A . B 2 HOH 15 175 174 HOH HOH A . B 2 HOH 16 176 175 HOH HOH A . B 2 HOH 17 177 176 HOH HOH A . B 2 HOH 18 178 177 HOH HOH A . B 2 HOH 19 179 178 HOH HOH A . B 2 HOH 20 180 179 HOH HOH A . B 2 HOH 21 181 180 HOH HOH A . B 2 HOH 22 182 181 HOH HOH A . B 2 HOH 23 183 182 HOH HOH A . B 2 HOH 24 184 183 HOH HOH A . B 2 HOH 25 185 184 HOH HOH A . B 2 HOH 26 186 185 HOH HOH A . B 2 HOH 27 187 186 HOH HOH A . B 2 HOH 28 188 187 HOH HOH A . B 2 HOH 29 189 188 HOH HOH A . B 2 HOH 30 190 189 HOH HOH A . B 2 HOH 31 191 190 HOH HOH A . B 2 HOH 32 192 191 HOH HOH A . B 2 HOH 33 193 192 HOH HOH A . B 2 HOH 34 194 193 HOH HOH A . B 2 HOH 35 195 194 HOH HOH A . B 2 HOH 36 196 195 HOH HOH A . B 2 HOH 37 197 196 HOH HOH A . B 2 HOH 38 198 197 HOH HOH A . B 2 HOH 39 199 198 HOH HOH A . B 2 HOH 40 200 199 HOH HOH A . B 2 HOH 41 201 200 HOH HOH A . B 2 HOH 42 202 201 HOH HOH A . #