data_1IY5 # _entry.id 1IY5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IY5 pdb_00001iy5 10.2210/pdb1iy5/pdb RCSB RCSB005395 ? ? WWPDB D_1000005395 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-03-11 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IY5 _pdbx_database_status.recvd_initial_deposition_date 2002-07-23 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1IY6 _pdbx_database_related.details '1IY6 contains OMSVP3 variant, P14C/N39C' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hemmi, H.' 1 'Kumazaki, T.' 2 'Yamazaki, T.' 3 'Kojima, S.' 4 'Yoshida, T.' 5 'Kyogoku, Y.' 6 'Katsu, M.' 7 'Yokosawa, H.' 8 'Miura, K.' 9 'Kobayashi, Y.' 10 # _citation.id primary _citation.title 'Inhibitory Specificity Change of Ovomucoid Third Domain of the Silver Pheasant upon Introduction of an Engineered Cys14-Cys39 Bond' _citation.journal_abbrev BIOCHEMISTRY _citation.journal_volume 42 _citation.page_first 2524 _citation.page_last 2534 _citation.year 2003 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12614146 _citation.pdbx_database_id_DOI 10.1021/bi026727c # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hemmi, H.' 1 ? primary 'Kumazaki, T.' 2 ? primary 'Yamazaki, T.' 3 ? primary 'Kojima, S.' 4 ? primary 'Yoshida, T.' 5 ? primary 'Kyogoku, Y.' 6 ? primary 'Katsu, M.' 7 ? primary 'Shinohara, F.' 8 ? primary 'Yokosawa, H.' 9 ? primary 'Miura, K.' 10 ? primary 'Kobayashi, Y.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description OMSVP3 _entity.formula_weight 5860.613 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'third domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ovomucoid # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC _entity_poly.pdbx_seq_one_letter_code_can AVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 VAL n 1 3 SER n 1 4 VAL n 1 5 ASP n 1 6 CYS n 1 7 SER n 1 8 GLU n 1 9 TYR n 1 10 PRO n 1 11 LYS n 1 12 PRO n 1 13 ALA n 1 14 CYS n 1 15 THR n 1 16 MET n 1 17 GLU n 1 18 TYR n 1 19 ARG n 1 20 PRO n 1 21 LEU n 1 22 CYS n 1 23 GLY n 1 24 SER n 1 25 ASP n 1 26 ASN n 1 27 LYS n 1 28 THR n 1 29 TYR n 1 30 GLY n 1 31 ASN n 1 32 LYS n 1 33 CYS n 1 34 ASN n 1 35 PHE n 1 36 CYS n 1 37 ASN n 1 38 ALA n 1 39 VAL n 1 40 VAL n 1 41 GLU n 1 42 SER n 1 43 ASN n 1 44 GLY n 1 45 THR n 1 46 LEU n 1 47 THR n 1 48 LEU n 1 49 SER n 1 50 HIS n 1 51 PHE n 1 52 GLY n 1 53 LYS n 1 54 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'silver pheasant' _entity_src_gen.gene_src_genus Lophura _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lophura nycthemera' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9046 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET22b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 3 3 ALA ALA A . n A 1 2 VAL 2 4 4 VAL VAL A . n A 1 3 SER 3 5 5 SER SER A . n A 1 4 VAL 4 6 6 VAL VAL A . n A 1 5 ASP 5 7 7 ASP ASP A . n A 1 6 CYS 6 8 8 CYS CYS A . n A 1 7 SER 7 9 9 SER SER A . n A 1 8 GLU 8 10 10 GLU GLU A . n A 1 9 TYR 9 11 11 TYR TYR A . n A 1 10 PRO 10 12 12 PRO PRO A . n A 1 11 LYS 11 13 13 LYS LYS A . n A 1 12 PRO 12 14 14 PRO PRO A . n A 1 13 ALA 13 15 15 ALA ALA A . n A 1 14 CYS 14 16 16 CYS CYS A . n A 1 15 THR 15 17 17 THR THR A . n A 1 16 MET 16 18 18 MET MET A . n A 1 17 GLU 17 19 19 GLU GLU A . n A 1 18 TYR 18 20 20 TYR TYR A . n A 1 19 ARG 19 21 21 ARG ARG A . n A 1 20 PRO 20 22 22 PRO PRO A . n A 1 21 LEU 21 23 23 LEU LEU A . n A 1 22 CYS 22 24 24 CYS CYS A . n A 1 23 GLY 23 25 25 GLY GLY A . n A 1 24 SER 24 26 26 SER SER A . n A 1 25 ASP 25 27 27 ASP ASP A . n A 1 26 ASN 26 28 28 ASN ASN A . n A 1 27 LYS 27 29 29 LYS LYS A . n A 1 28 THR 28 30 30 THR THR A . n A 1 29 TYR 29 31 31 TYR TYR A . n A 1 30 GLY 30 32 32 GLY GLY A . n A 1 31 ASN 31 33 33 ASN ASN A . n A 1 32 LYS 32 34 34 LYS LYS A . n A 1 33 CYS 33 35 35 CYS CYS A . n A 1 34 ASN 34 36 36 ASN ASN A . n A 1 35 PHE 35 37 37 PHE PHE A . n A 1 36 CYS 36 38 38 CYS CYS A . n A 1 37 ASN 37 39 39 ASN ASN A . n A 1 38 ALA 38 40 40 ALA ALA A . n A 1 39 VAL 39 41 41 VAL VAL A . n A 1 40 VAL 40 42 42 VAL VAL A . n A 1 41 GLU 41 43 43 GLU GLU A . n A 1 42 SER 42 44 44 SER SER A . n A 1 43 ASN 43 45 45 ASN ASN A . n A 1 44 GLY 44 46 46 GLY GLY A . n A 1 45 THR 45 47 47 THR THR A . n A 1 46 LEU 46 48 48 LEU LEU A . n A 1 47 THR 47 49 49 THR THR A . n A 1 48 LEU 48 50 50 LEU LEU A . n A 1 49 SER 49 51 51 SER SER A . n A 1 50 HIS 50 52 52 HIS HIS A . n A 1 51 PHE 51 53 53 PHE PHE A . n A 1 52 GLY 52 54 54 GLY GLY A . n A 1 53 LYS 53 55 55 LYS LYS A . n A 1 54 CYS 54 56 56 CYS CYS A . n # _exptl.entry_id 1IY5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1IY5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1IY5 _struct.title 'Solution structure of wild type OMSVP3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IY5 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'solution structure, CSH motif, OMSVP3, ovomucoid third domain, protease inhibitor, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_code IOVO_LOPNY _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P67954 _struct_ref.pdbx_align_begin 3 _struct_ref.pdbx_seq_one_letter_code AVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IY5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P67954 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 56 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 56 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 31 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 43 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 33 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 45 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 8 A CYS 38 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 16 A CYS 35 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 24 A CYS 56 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 1 1.15 2 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 2 0.28 3 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 3 -0.06 4 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 4 0.55 5 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 5 0.50 6 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 6 0.71 7 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 7 0.37 8 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 8 0.05 9 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 9 0.73 10 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 10 0.35 11 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 11 0.19 12 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 12 0.01 13 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 13 -0.01 14 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 14 1.51 15 TYR 9 A . ? TYR 11 A PRO 10 A ? PRO 12 A 15 0.82 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 27 ? TYR A 29 ? LYS A 29 TYR A 31 A 2 LEU A 21 ? GLY A 23 ? LEU A 23 GLY A 25 A 3 LEU A 48 ? HIS A 50 ? LEU A 50 HIS A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 27 ? O LYS A 29 N GLY A 23 ? N GLY A 25 A 2 3 N CYS A 22 ? N CYS A 24 O SER A 49 ? O SER A 51 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 6 ? ? 55.72 164.80 2 1 CYS A 8 ? ? -102.25 55.04 3 1 ALA A 15 ? ? 169.06 146.89 4 1 TYR A 20 ? ? -97.66 45.72 5 1 ASN A 33 ? ? 177.71 173.88 6 1 THR A 49 ? ? -120.36 -165.04 7 1 HIS A 52 ? ? 178.98 108.33 8 1 PHE A 53 ? ? -43.63 92.48 9 2 SER A 5 ? ? 161.20 -57.16 10 2 CYS A 8 ? ? -99.67 53.35 11 2 GLU A 10 ? ? -89.33 44.34 12 2 ASN A 33 ? ? 176.37 -165.32 13 2 THR A 49 ? ? -132.20 -149.98 14 2 HIS A 52 ? ? 177.61 104.84 15 2 PHE A 53 ? ? -44.84 93.83 16 3 ASP A 7 ? ? -69.50 86.48 17 3 CYS A 8 ? ? -89.15 31.75 18 3 GLU A 10 ? ? -90.87 35.00 19 3 GLU A 19 ? ? -54.95 173.07 20 3 TYR A 20 ? ? -140.80 37.18 21 3 ASN A 33 ? ? 172.87 172.09 22 3 THR A 49 ? ? -123.85 -152.03 23 3 HIS A 52 ? ? 176.99 110.07 24 3 PHE A 53 ? ? -42.27 93.72 25 4 VAL A 4 ? ? -137.41 -48.53 26 4 SER A 5 ? ? 175.57 -58.25 27 4 ASN A 33 ? ? 173.71 169.77 28 4 ASN A 45 ? ? 75.51 -0.47 29 4 THR A 47 ? ? -101.46 42.48 30 4 THR A 49 ? ? -109.60 -157.09 31 4 HIS A 52 ? ? 167.55 105.15 32 4 PHE A 53 ? ? -47.00 99.88 33 5 SER A 5 ? ? 49.46 -91.70 34 5 CYS A 8 ? ? -81.90 45.17 35 5 ALA A 15 ? ? -176.62 144.11 36 5 CYS A 16 ? ? -126.31 -166.54 37 5 SER A 26 ? ? -48.84 -18.17 38 5 ASN A 33 ? ? 175.09 -172.47 39 5 ASN A 45 ? ? 76.90 -0.47 40 5 THR A 49 ? ? -137.75 -153.55 41 5 HIS A 52 ? ? 178.09 109.55 42 5 PHE A 53 ? ? -44.60 103.67 43 6 CYS A 8 ? ? -80.66 40.44 44 6 ALA A 15 ? ? 168.58 -171.36 45 6 ASN A 33 ? ? 172.84 -168.17 46 6 THR A 49 ? ? -98.22 -152.63 47 6 HIS A 52 ? ? 177.73 111.62 48 6 PHE A 53 ? ? -43.35 93.86 49 7 SER A 5 ? ? 83.97 -56.48 50 7 CYS A 16 ? ? -116.44 -164.39 51 7 ASN A 33 ? ? -174.06 -176.38 52 7 THR A 47 ? ? -87.96 39.42 53 7 THR A 49 ? ? -100.88 -152.36 54 7 HIS A 52 ? ? 177.61 111.39 55 7 PHE A 53 ? ? -43.33 94.41 56 8 VAL A 4 ? ? -87.46 -118.29 57 8 ASP A 7 ? ? -96.87 33.35 58 8 CYS A 8 ? ? 13.76 65.07 59 8 SER A 9 ? ? -29.75 -65.68 60 8 TYR A 20 ? ? -100.49 41.25 61 8 ASN A 33 ? ? 173.70 166.47 62 8 THR A 49 ? ? -122.41 -151.98 63 8 HIS A 52 ? ? 172.68 105.30 64 8 PHE A 53 ? ? -46.92 97.05 65 9 SER A 5 ? ? 43.84 76.48 66 9 ALA A 15 ? ? -170.67 -178.45 67 9 TYR A 20 ? ? -140.96 35.86 68 9 SER A 26 ? ? -48.69 -18.77 69 9 ASN A 33 ? ? 175.56 172.82 70 9 THR A 49 ? ? -125.41 -154.53 71 9 HIS A 52 ? ? 178.81 108.13 72 9 PHE A 53 ? ? -44.11 99.81 73 10 SER A 5 ? ? -90.02 31.61 74 10 SER A 9 ? ? -34.67 -75.84 75 10 ASN A 33 ? ? 173.77 -178.48 76 10 HIS A 52 ? ? 177.55 108.82 77 10 PHE A 53 ? ? -44.61 96.02 78 11 GLU A 10 ? ? -86.79 35.76 79 11 ASN A 28 ? ? 71.44 38.05 80 11 ASN A 33 ? ? 179.26 169.10 81 11 THR A 49 ? ? -128.81 -151.23 82 11 HIS A 52 ? ? -176.71 110.68 83 11 PHE A 53 ? ? -44.66 94.98 84 12 VAL A 4 ? ? -100.50 -80.07 85 12 SER A 5 ? ? -143.67 11.15 86 12 GLU A 10 ? ? -93.79 40.60 87 12 ASN A 33 ? ? 178.50 175.88 88 12 THR A 49 ? ? -98.72 -152.63 89 12 HIS A 52 ? ? 179.34 114.55 90 12 PHE A 53 ? ? -44.51 92.63 91 13 VAL A 4 ? ? -135.39 -54.43 92 13 SER A 5 ? ? 56.65 161.68 93 13 SER A 9 ? ? -35.91 -70.04 94 13 CYS A 16 ? ? -103.09 -168.46 95 13 ASN A 33 ? ? 176.90 -169.40 96 13 THR A 49 ? ? -130.88 -150.96 97 13 HIS A 52 ? ? -177.02 104.65 98 13 PHE A 53 ? ? -42.96 96.50 99 14 SER A 5 ? ? 69.37 122.04 100 14 ASP A 7 ? ? 34.00 -133.48 101 14 ALA A 15 ? ? 169.92 126.97 102 14 SER A 26 ? ? -49.88 -17.66 103 14 ASN A 33 ? ? 175.77 -172.70 104 14 THR A 49 ? ? -125.38 -147.49 105 14 SER A 51 ? ? -130.88 -31.73 106 14 HIS A 52 ? ? 177.60 106.77 107 15 VAL A 4 ? ? -114.50 -133.81 108 15 SER A 5 ? ? 76.22 163.21 109 15 SER A 9 ? ? -44.08 84.86 110 15 GLU A 10 ? ? 40.14 84.87 111 15 TYR A 20 ? ? -91.07 44.43 112 15 ASN A 33 ? ? 178.98 -168.92 113 15 ASN A 45 ? ? 81.03 -4.24 114 15 THR A 49 ? ? -134.91 -151.74 115 15 HIS A 52 ? ? 178.19 108.71 116 15 PHE A 53 ? ? -42.65 95.12 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 21 ? ? 0.316 'SIDE CHAIN' 2 2 ARG A 21 ? ? 0.162 'SIDE CHAIN' 3 3 ARG A 21 ? ? 0.283 'SIDE CHAIN' 4 4 ARG A 21 ? ? 0.211 'SIDE CHAIN' 5 5 ARG A 21 ? ? 0.241 'SIDE CHAIN' 6 6 ARG A 21 ? ? 0.303 'SIDE CHAIN' 7 7 ARG A 21 ? ? 0.287 'SIDE CHAIN' 8 8 ARG A 21 ? ? 0.183 'SIDE CHAIN' 9 9 ARG A 21 ? ? 0.194 'SIDE CHAIN' 10 10 ARG A 21 ? ? 0.301 'SIDE CHAIN' 11 11 ARG A 21 ? ? 0.307 'SIDE CHAIN' 12 12 ARG A 21 ? ? 0.180 'SIDE CHAIN' 13 13 ARG A 21 ? ? 0.284 'SIDE CHAIN' 14 14 ARG A 21 ? ? 0.309 'SIDE CHAIN' 15 15 ARG A 21 ? ? 0.109 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1IY5 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'low total energy and low deviation from mean structure' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1IY5 _pdbx_nmr_representative.conformer_id 11 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '4.0mM OMSVP3; 90%H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 NOESY 2 1 1 DQF-COSY 3 1 1 TOCSY # _pdbx_nmr_details.entry_id 1IY5 _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_refine.entry_id 1IY5 _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 2.1 processing Delaglio 2 NMRPIPP 4.3.2 'data analysis' Garrett 3 X-PLOR 3.1 refinement Brunger 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 HIS N N N N 117 HIS CA C N S 118 HIS C C N N 119 HIS O O N N 120 HIS CB C N N 121 HIS CG C Y N 122 HIS ND1 N Y N 123 HIS CD2 C Y N 124 HIS CE1 C Y N 125 HIS NE2 N Y N 126 HIS OXT O N N 127 HIS H H N N 128 HIS H2 H N N 129 HIS HA H N N 130 HIS HB2 H N N 131 HIS HB3 H N N 132 HIS HD1 H N N 133 HIS HD2 H N N 134 HIS HE1 H N N 135 HIS HE2 H N N 136 HIS HXT H N N 137 LEU N N N N 138 LEU CA C N S 139 LEU C C N N 140 LEU O O N N 141 LEU CB C N N 142 LEU CG C N N 143 LEU CD1 C N N 144 LEU CD2 C N N 145 LEU OXT O N N 146 LEU H H N N 147 LEU H2 H N N 148 LEU HA H N N 149 LEU HB2 H N N 150 LEU HB3 H N N 151 LEU HG H N N 152 LEU HD11 H N N 153 LEU HD12 H N N 154 LEU HD13 H N N 155 LEU HD21 H N N 156 LEU HD22 H N N 157 LEU HD23 H N N 158 LEU HXT H N N 159 LYS N N N N 160 LYS CA C N S 161 LYS C C N N 162 LYS O O N N 163 LYS CB C N N 164 LYS CG C N N 165 LYS CD C N N 166 LYS CE C N N 167 LYS NZ N N N 168 LYS OXT O N N 169 LYS H H N N 170 LYS H2 H N N 171 LYS HA H N N 172 LYS HB2 H N N 173 LYS HB3 H N N 174 LYS HG2 H N N 175 LYS HG3 H N N 176 LYS HD2 H N N 177 LYS HD3 H N N 178 LYS HE2 H N N 179 LYS HE3 H N N 180 LYS HZ1 H N N 181 LYS HZ2 H N N 182 LYS HZ3 H N N 183 LYS HXT H N N 184 MET N N N N 185 MET CA C N S 186 MET C C N N 187 MET O O N N 188 MET CB C N N 189 MET CG C N N 190 MET SD S N N 191 MET CE C N N 192 MET OXT O N N 193 MET H H N N 194 MET H2 H N N 195 MET HA H N N 196 MET HB2 H N N 197 MET HB3 H N N 198 MET HG2 H N N 199 MET HG3 H N N 200 MET HE1 H N N 201 MET HE2 H N N 202 MET HE3 H N N 203 MET HXT H N N 204 PHE N N N N 205 PHE CA C N S 206 PHE C C N N 207 PHE O O N N 208 PHE CB C N N 209 PHE CG C Y N 210 PHE CD1 C Y N 211 PHE CD2 C Y N 212 PHE CE1 C Y N 213 PHE CE2 C Y N 214 PHE CZ C Y N 215 PHE OXT O N N 216 PHE H H N N 217 PHE H2 H N N 218 PHE HA H N N 219 PHE HB2 H N N 220 PHE HB3 H N N 221 PHE HD1 H N N 222 PHE HD2 H N N 223 PHE HE1 H N N 224 PHE HE2 H N N 225 PHE HZ H N N 226 PHE HXT H N N 227 PRO N N N N 228 PRO CA C N S 229 PRO C C N N 230 PRO O O N N 231 PRO CB C N N 232 PRO CG C N N 233 PRO CD C N N 234 PRO OXT O N N 235 PRO H H N N 236 PRO HA H N N 237 PRO HB2 H N N 238 PRO HB3 H N N 239 PRO HG2 H N N 240 PRO HG3 H N N 241 PRO HD2 H N N 242 PRO HD3 H N N 243 PRO HXT H N N 244 SER N N N N 245 SER CA C N S 246 SER C C N N 247 SER O O N N 248 SER CB C N N 249 SER OG O N N 250 SER OXT O N N 251 SER H H N N 252 SER H2 H N N 253 SER HA H N N 254 SER HB2 H N N 255 SER HB3 H N N 256 SER HG H N N 257 SER HXT H N N 258 THR N N N N 259 THR CA C N S 260 THR C C N N 261 THR O O N N 262 THR CB C N R 263 THR OG1 O N N 264 THR CG2 C N N 265 THR OXT O N N 266 THR H H N N 267 THR H2 H N N 268 THR HA H N N 269 THR HB H N N 270 THR HG1 H N N 271 THR HG21 H N N 272 THR HG22 H N N 273 THR HG23 H N N 274 THR HXT H N N 275 TYR N N N N 276 TYR CA C N S 277 TYR C C N N 278 TYR O O N N 279 TYR CB C N N 280 TYR CG C Y N 281 TYR CD1 C Y N 282 TYR CD2 C Y N 283 TYR CE1 C Y N 284 TYR CE2 C Y N 285 TYR CZ C Y N 286 TYR OH O N N 287 TYR OXT O N N 288 TYR H H N N 289 TYR H2 H N N 290 TYR HA H N N 291 TYR HB2 H N N 292 TYR HB3 H N N 293 TYR HD1 H N N 294 TYR HD2 H N N 295 TYR HE1 H N N 296 TYR HE2 H N N 297 TYR HH H N N 298 TYR HXT H N N 299 VAL N N N N 300 VAL CA C N S 301 VAL C C N N 302 VAL O O N N 303 VAL CB C N N 304 VAL CG1 C N N 305 VAL CG2 C N N 306 VAL OXT O N N 307 VAL H H N N 308 VAL H2 H N N 309 VAL HA H N N 310 VAL HB H N N 311 VAL HG11 H N N 312 VAL HG12 H N N 313 VAL HG13 H N N 314 VAL HG21 H N N 315 VAL HG22 H N N 316 VAL HG23 H N N 317 VAL HXT H N N 318 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 LEU N CA sing N N 131 LEU N H sing N N 132 LEU N H2 sing N N 133 LEU CA C sing N N 134 LEU CA CB sing N N 135 LEU CA HA sing N N 136 LEU C O doub N N 137 LEU C OXT sing N N 138 LEU CB CG sing N N 139 LEU CB HB2 sing N N 140 LEU CB HB3 sing N N 141 LEU CG CD1 sing N N 142 LEU CG CD2 sing N N 143 LEU CG HG sing N N 144 LEU CD1 HD11 sing N N 145 LEU CD1 HD12 sing N N 146 LEU CD1 HD13 sing N N 147 LEU CD2 HD21 sing N N 148 LEU CD2 HD22 sing N N 149 LEU CD2 HD23 sing N N 150 LEU OXT HXT sing N N 151 LYS N CA sing N N 152 LYS N H sing N N 153 LYS N H2 sing N N 154 LYS CA C sing N N 155 LYS CA CB sing N N 156 LYS CA HA sing N N 157 LYS C O doub N N 158 LYS C OXT sing N N 159 LYS CB CG sing N N 160 LYS CB HB2 sing N N 161 LYS CB HB3 sing N N 162 LYS CG CD sing N N 163 LYS CG HG2 sing N N 164 LYS CG HG3 sing N N 165 LYS CD CE sing N N 166 LYS CD HD2 sing N N 167 LYS CD HD3 sing N N 168 LYS CE NZ sing N N 169 LYS CE HE2 sing N N 170 LYS CE HE3 sing N N 171 LYS NZ HZ1 sing N N 172 LYS NZ HZ2 sing N N 173 LYS NZ HZ3 sing N N 174 LYS OXT HXT sing N N 175 MET N CA sing N N 176 MET N H sing N N 177 MET N H2 sing N N 178 MET CA C sing N N 179 MET CA CB sing N N 180 MET CA HA sing N N 181 MET C O doub N N 182 MET C OXT sing N N 183 MET CB CG sing N N 184 MET CB HB2 sing N N 185 MET CB HB3 sing N N 186 MET CG SD sing N N 187 MET CG HG2 sing N N 188 MET CG HG3 sing N N 189 MET SD CE sing N N 190 MET CE HE1 sing N N 191 MET CE HE2 sing N N 192 MET CE HE3 sing N N 193 MET OXT HXT sing N N 194 PHE N CA sing N N 195 PHE N H sing N N 196 PHE N H2 sing N N 197 PHE CA C sing N N 198 PHE CA CB sing N N 199 PHE CA HA sing N N 200 PHE C O doub N N 201 PHE C OXT sing N N 202 PHE CB CG sing N N 203 PHE CB HB2 sing N N 204 PHE CB HB3 sing N N 205 PHE CG CD1 doub Y N 206 PHE CG CD2 sing Y N 207 PHE CD1 CE1 sing Y N 208 PHE CD1 HD1 sing N N 209 PHE CD2 CE2 doub Y N 210 PHE CD2 HD2 sing N N 211 PHE CE1 CZ doub Y N 212 PHE CE1 HE1 sing N N 213 PHE CE2 CZ sing Y N 214 PHE CE2 HE2 sing N N 215 PHE CZ HZ sing N N 216 PHE OXT HXT sing N N 217 PRO N CA sing N N 218 PRO N CD sing N N 219 PRO N H sing N N 220 PRO CA C sing N N 221 PRO CA CB sing N N 222 PRO CA HA sing N N 223 PRO C O doub N N 224 PRO C OXT sing N N 225 PRO CB CG sing N N 226 PRO CB HB2 sing N N 227 PRO CB HB3 sing N N 228 PRO CG CD sing N N 229 PRO CG HG2 sing N N 230 PRO CG HG3 sing N N 231 PRO CD HD2 sing N N 232 PRO CD HD3 sing N N 233 PRO OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 THR N CA sing N N 248 THR N H sing N N 249 THR N H2 sing N N 250 THR CA C sing N N 251 THR CA CB sing N N 252 THR CA HA sing N N 253 THR C O doub N N 254 THR C OXT sing N N 255 THR CB OG1 sing N N 256 THR CB CG2 sing N N 257 THR CB HB sing N N 258 THR OG1 HG1 sing N N 259 THR CG2 HG21 sing N N 260 THR CG2 HG22 sing N N 261 THR CG2 HG23 sing N N 262 THR OXT HXT sing N N 263 TYR N CA sing N N 264 TYR N H sing N N 265 TYR N H2 sing N N 266 TYR CA C sing N N 267 TYR CA CB sing N N 268 TYR CA HA sing N N 269 TYR C O doub N N 270 TYR C OXT sing N N 271 TYR CB CG sing N N 272 TYR CB HB2 sing N N 273 TYR CB HB3 sing N N 274 TYR CG CD1 doub Y N 275 TYR CG CD2 sing Y N 276 TYR CD1 CE1 sing Y N 277 TYR CD1 HD1 sing N N 278 TYR CD2 CE2 doub Y N 279 TYR CD2 HD2 sing N N 280 TYR CE1 CZ doub Y N 281 TYR CE1 HE1 sing N N 282 TYR CE2 CZ sing Y N 283 TYR CE2 HE2 sing N N 284 TYR CZ OH sing N N 285 TYR OH HH sing N N 286 TYR OXT HXT sing N N 287 VAL N CA sing N N 288 VAL N H sing N N 289 VAL N H2 sing N N 290 VAL CA C sing N N 291 VAL CA CB sing N N 292 VAL CA HA sing N N 293 VAL C O doub N N 294 VAL C OXT sing N N 295 VAL CB CG1 sing N N 296 VAL CB CG2 sing N N 297 VAL CB HB sing N N 298 VAL CG1 HG11 sing N N 299 VAL CG1 HG12 sing N N 300 VAL CG1 HG13 sing N N 301 VAL CG2 HG21 sing N N 302 VAL CG2 HG22 sing N N 303 VAL CG2 HG23 sing N N 304 VAL OXT HXT sing N N 305 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AMX 500 2 ? Bruker DRX 600 # _atom_sites.entry_id 1IY5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_