data_1JMN # _entry.id 1JMN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1JMN pdb_00001jmn 10.2210/pdb1jmn/pdb RCSB RCSB013942 ? ? WWPDB D_1000013942 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JMN _pdbx_database_status.recvd_initial_deposition_date 2001-07-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mosbah, A.' 1 'Coulon, A.' 2 'Bernard, C.' 3 'Urech, K.' 4 'Rouge, P.' 5 'Darbon, H.' 6 # _citation.id primary _citation.title 'Solution Structure of the Viscotoxin A2' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mosbah, A.' 1 ? primary 'Coulon, A.' 2 ? primary 'Bernard, C.' 3 ? primary 'Urech, K.' 4 ? primary 'Rouge, P.' 5 ? primary 'Darbon, H.' 6 ? # _cell.entry_id 1JMN _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'viscotoxin A2' _entity.formula_weight 4839.519 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK _entity_poly.pdbx_seq_one_letter_code_can KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 SER n 1 3 CYS n 1 4 CYS n 1 5 PRO n 1 6 ASN n 1 7 THR n 1 8 THR n 1 9 GLY n 1 10 ARG n 1 11 ASN n 1 12 ILE n 1 13 TYR n 1 14 ASN n 1 15 THR n 1 16 CYS n 1 17 ARG n 1 18 PHE n 1 19 GLY n 1 20 GLY n 1 21 GLY n 1 22 SER n 1 23 ARG n 1 24 GLN n 1 25 VAL n 1 26 CYS n 1 27 ALA n 1 28 SER n 1 29 LEU n 1 30 SER n 1 31 GLY n 1 32 CYS n 1 33 LYS n 1 34 ILE n 1 35 ILE n 1 36 SER n 1 37 ALA n 1 38 SER n 1 39 THR n 1 40 CYS n 1 41 PRO n 1 42 SER n 1 43 ASP n 1 44 TYR n 1 45 PRO n 1 46 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'European mistletoe' _entity_src_gen.gene_src_genus Viscum _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Viscum album' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3972 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THN2_VISAL _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P32880 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1JMN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32880 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 46 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1JMN GLN A 24 ? UNP P32880 GLU 24 'SEE REMARK 999' 24 1 1 1JMN ASP A 43 ? UNP P32880 TYR 43 'SEE REMARK 999' 43 2 1 1JMN TYR A 44 ? UNP P32880 PRO 44 'SEE REMARK 999' 44 3 1 1JMN PRO A 45 ? UNP P32880 ASP 45 'SEE REMARK 999' 45 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pH 5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_ensemble.entry_id 1JMN _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ;back calculated data agree with experimental NOESY spectrum, structures with acceptable covalent geometry, structures with favorable non-bond energy ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1JMN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations,lowest energy' # _pdbx_nmr_software.name CNS _pdbx_nmr_software.version 1.0 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1JMN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1JMN _struct.title 'Solution Structure of the Viscotoxin A2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1JMN _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'thionin, viscotoxin, Viscum album, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 6 ? PHE A 18 ? ASN A 6 PHE A 18 1 ? 13 HELX_P HELX_P2 2 ARG A 23 ? GLY A 31 ? ARG A 23 GLY A 31 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 3 A CYS 40 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 4 A CYS 32 1_555 ? ? ? ? ? ? ? 1.954 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 16 A CYS 26 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 2 ? CYS A 3 ? SER A 2 CYS A 3 A 2 LYS A 33 ? ILE A 34 ? LYS A 33 ILE A 34 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 3 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 3 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 33 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 33 # _database_PDB_matrix.entry_id 1JMN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1JMN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LYS 46 46 46 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-06-24 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 3 CE2 A TYR 13 ? ? CD2 A TYR 13 ? ? 1.292 1.389 -0.097 0.015 N 2 4 CE2 A TYR 13 ? ? CD2 A TYR 13 ? ? 1.296 1.389 -0.093 0.015 N 3 5 CE2 A TYR 13 ? ? CD2 A TYR 13 ? ? 1.269 1.389 -0.120 0.015 N 4 8 CG A TYR 13 ? ? CD1 A TYR 13 ? ? 1.306 1.387 -0.081 0.013 N 5 14 CG A TYR 13 ? ? CD1 A TYR 13 ? ? 1.306 1.387 -0.081 0.013 N 6 14 CE1 A TYR 13 ? ? CZ A TYR 13 ? ? 1.295 1.381 -0.086 0.013 N 7 18 CE2 A TYR 13 ? ? CD2 A TYR 13 ? ? 1.290 1.389 -0.099 0.015 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 22 ? ? -138.37 -148.74 2 1 SER A 36 ? ? -97.07 32.96 3 1 ALA A 37 ? ? -166.93 -167.69 4 1 PRO A 41 ? ? -72.47 -165.65 5 1 SER A 42 ? ? -83.15 45.91 6 1 TYR A 44 ? ? 48.03 87.56 7 2 SER A 22 ? ? -62.95 -148.83 8 2 ALA A 37 ? ? -178.87 -156.09 9 2 CYS A 40 ? ? 51.40 108.30 10 2 PRO A 41 ? ? -56.59 -157.95 11 2 SER A 42 ? ? -80.12 42.36 12 2 ASP A 43 ? ? -106.32 44.59 13 2 TYR A 44 ? ? 47.60 88.98 14 3 SER A 22 ? ? -139.68 -149.31 15 3 SER A 36 ? ? -97.20 33.85 16 3 PRO A 41 ? ? -73.88 -164.80 17 3 SER A 42 ? ? -79.56 42.23 18 3 TYR A 44 ? ? 48.57 88.00 19 4 SER A 22 ? ? -62.62 -149.02 20 4 ALA A 37 ? ? 179.46 -171.27 21 4 PRO A 41 ? ? -62.25 -162.06 22 4 SER A 42 ? ? -79.52 42.61 23 4 TYR A 44 ? ? 46.00 88.18 24 5 PRO A 5 ? ? -41.39 -72.99 25 5 SER A 22 ? ? -176.13 -128.90 26 5 SER A 36 ? ? -96.44 33.33 27 5 PRO A 41 ? ? -68.97 -161.54 28 5 SER A 42 ? ? -81.97 44.13 29 5 ASP A 43 ? ? -109.92 47.48 30 5 TYR A 44 ? ? 46.41 77.26 31 6 SER A 22 ? ? -132.87 -146.80 32 6 SER A 36 ? ? -97.78 33.45 33 6 ALA A 37 ? ? -178.49 -170.46 34 6 SER A 42 ? ? 39.14 15.64 35 6 ASP A 43 ? ? -97.51 37.35 36 6 TYR A 44 ? ? 46.98 82.87 37 7 ASN A 6 ? ? -177.43 -175.87 38 7 SER A 22 ? ? -63.24 -148.36 39 7 SER A 36 ? ? -97.73 33.22 40 7 PRO A 41 ? ? -68.06 -163.47 41 7 SER A 42 ? ? -81.98 45.11 42 7 TYR A 44 ? ? 47.70 82.85 43 8 SER A 22 ? ? -62.98 -148.97 44 8 ALA A 37 ? ? -177.75 -164.59 45 8 PRO A 41 ? ? -71.19 -167.02 46 8 SER A 42 ? ? -83.04 45.41 47 8 TYR A 44 ? ? 49.25 94.44 48 9 SER A 2 ? ? -175.54 121.08 49 9 CYS A 3 ? ? -62.59 86.71 50 9 SER A 22 ? ? -63.27 -148.36 51 9 SER A 36 ? ? -98.69 34.56 52 9 CYS A 40 ? ? -170.82 136.10 53 9 PRO A 41 ? ? -56.90 -160.77 54 9 SER A 42 ? ? -82.10 45.03 55 9 ASP A 43 ? ? -106.00 43.24 56 9 TYR A 44 ? ? 48.19 74.74 57 10 SER A 22 ? ? -136.98 -148.90 58 10 ALA A 37 ? ? -177.47 -164.55 59 10 PRO A 41 ? ? -74.05 -163.20 60 10 SER A 42 ? ? -80.42 43.50 61 10 TYR A 44 ? ? 49.49 90.04 62 11 SER A 22 ? ? -139.00 -147.64 63 11 ALA A 37 ? ? -176.49 -163.91 64 11 THR A 39 ? ? -138.50 -123.40 65 11 CYS A 40 ? ? -175.96 116.82 66 11 PRO A 41 ? ? -49.64 -177.11 67 11 SER A 42 ? ? -82.83 46.65 68 11 TYR A 44 ? ? 52.30 91.67 69 12 SER A 22 ? ? -63.09 -149.27 70 12 PRO A 41 ? ? -65.01 -162.00 71 12 SER A 42 ? ? -81.30 44.26 72 12 TYR A 44 ? ? 46.92 83.76 73 13 SER A 22 ? ? -136.94 -146.20 74 13 ALA A 37 ? ? -172.40 -173.68 75 13 PRO A 41 ? ? -73.89 -162.87 76 13 SER A 42 ? ? -82.27 45.14 77 13 ASP A 43 ? ? -119.03 51.94 78 13 TYR A 44 ? ? 48.57 86.57 79 14 SER A 22 ? ? -176.99 -129.71 80 14 ARG A 23 ? ? -107.79 -60.79 81 14 ALA A 37 ? ? -176.61 -163.10 82 14 PRO A 41 ? ? -66.52 -171.71 83 14 SER A 42 ? ? -82.98 45.05 84 14 TYR A 44 ? ? 51.21 98.75 85 15 PRO A 5 ? ? -42.12 -71.60 86 15 SER A 22 ? ? -62.38 -148.72 87 15 ALA A 37 ? ? 178.83 -169.21 88 15 PRO A 41 ? ? -72.86 -162.07 89 15 SER A 42 ? ? -81.41 44.21 90 15 TYR A 44 ? ? 43.61 84.34 91 16 SER A 22 ? ? -140.24 -145.57 92 16 SER A 36 ? ? -97.60 33.52 93 16 PRO A 41 ? ? -62.10 -161.94 94 16 SER A 42 ? ? -82.06 45.78 95 16 TYR A 44 ? ? 46.11 84.46 96 17 SER A 22 ? ? -133.87 -146.09 97 17 ALA A 37 ? ? -177.60 -164.24 98 17 PRO A 41 ? ? -72.56 -164.67 99 17 SER A 42 ? ? -82.49 44.65 100 17 ASP A 43 ? ? -117.28 50.13 101 17 TYR A 44 ? ? 45.37 88.52 102 18 SER A 22 ? ? -62.66 -148.61 103 18 ALA A 37 ? ? -178.11 -163.96 104 18 PRO A 41 ? ? -67.00 -164.99 105 18 SER A 42 ? ? -82.40 44.48 106 18 ASP A 43 ? ? -114.98 50.19 107 18 TYR A 44 ? ? 44.75 85.27 108 18 PRO A 45 ? ? -69.47 75.32 109 19 SER A 22 ? ? -63.09 -149.46 110 19 ALA A 37 ? ? -177.23 -163.95 111 19 PRO A 41 ? ? -72.96 -163.71 112 19 SER A 42 ? ? -80.41 43.83 113 19 TYR A 44 ? ? 49.14 94.24 114 20 SER A 22 ? ? -138.33 -148.81 115 20 ALA A 37 ? ? -176.92 -167.16 116 20 PRO A 41 ? ? -68.78 -162.73 117 20 SER A 42 ? ? -81.51 43.51 118 20 TYR A 44 ? ? 46.47 83.68 #