data_1KA7 # _entry.id 1KA7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KA7 pdb_00001ka7 10.2210/pdb1ka7/pdb RCSB RCSB014753 ? ? WWPDB D_1000014753 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1KA6 _pdbx_database_related.details 'SAP/SH2D1A bound to peptide n-pY' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KA7 _pdbx_database_status.recvd_initial_deposition_date 2001-10-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hwang, P.M.' 1 'Li, C.' 2 'Morra, M.' 3 'Lillywhite, J.' 4 'Gertler, F.' 5 'Terhorst, C.' 6 'Kay, L.E.' 7 'Pawson, T.' 8 'Forman-Kay, J.' 9 'Li, S.-C.' 10 # _citation.id primary _citation.title ;A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome. ; _citation.journal_abbrev 'EMBO J.' _citation.journal_volume 21 _citation.page_first 314 _citation.page_last 323 _citation.year 2002 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11823424 _citation.pdbx_database_id_DOI 10.1093/emboj/21.3.314 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hwang, P.M.' 1 ? primary 'Li, C.' 2 ? primary 'Morra, M.' 3 ? primary 'Lillywhite, J.' 4 ? primary 'Muhandiram, D.R.' 5 ? primary 'Gertler, F.' 6 ? primary 'Terhorst, C.' 7 ? primary 'Kay, L.E.' 8 ? primary 'Pawson, T.' 9 ? primary 'Forman-Kay, J.D.' 10 ? primary 'Li, S.C.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SH2 DOMAIN PROTEIN 1A' 14206.181 1 ? ? ? ? 2 polymer syn 'peptide n-Y-c' 1437.706 1 ? K275R 'Cytoplasmic region (residues 275-286)' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'SLAM-ASSOCIATED PROTEIN' 2 'SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKI KNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP ; ;MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKI KNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP ; A ? 2 'polypeptide(L)' no no RKSLTIYAQVQK RKSLTIYAQVQK B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ALA n 1 4 VAL n 1 5 ALA n 1 6 VAL n 1 7 TYR n 1 8 HIS n 1 9 GLY n 1 10 LYS n 1 11 ILE n 1 12 SER n 1 13 ARG n 1 14 GLU n 1 15 THR n 1 16 GLY n 1 17 GLU n 1 18 LYS n 1 19 LEU n 1 20 LEU n 1 21 LEU n 1 22 ALA n 1 23 THR n 1 24 GLY n 1 25 LEU n 1 26 ASP n 1 27 GLY n 1 28 SER n 1 29 TYR n 1 30 LEU n 1 31 LEU n 1 32 ARG n 1 33 ASP n 1 34 SER n 1 35 GLU n 1 36 SER n 1 37 VAL n 1 38 PRO n 1 39 GLY n 1 40 VAL n 1 41 TYR n 1 42 CYS n 1 43 LEU n 1 44 CYS n 1 45 VAL n 1 46 LEU n 1 47 TYR n 1 48 HIS n 1 49 GLY n 1 50 TYR n 1 51 ILE n 1 52 TYR n 1 53 THR n 1 54 TYR n 1 55 ARG n 1 56 VAL n 1 57 SER n 1 58 GLN n 1 59 THR n 1 60 GLU n 1 61 THR n 1 62 GLY n 1 63 SER n 1 64 TRP n 1 65 SER n 1 66 ALA n 1 67 GLU n 1 68 THR n 1 69 ALA n 1 70 PRO n 1 71 GLY n 1 72 VAL n 1 73 HIS n 1 74 LYS n 1 75 ARG n 1 76 TYR n 1 77 PHE n 1 78 ARG n 1 79 LYS n 1 80 ILE n 1 81 LYS n 1 82 ASN n 1 83 LEU n 1 84 ILE n 1 85 SER n 1 86 ALA n 1 87 PHE n 1 88 GLN n 1 89 LYS n 1 90 PRO n 1 91 ASP n 1 92 GLN n 1 93 GLY n 1 94 ILE n 1 95 VAL n 1 96 ILE n 1 97 PRO n 1 98 LEU n 1 99 GLN n 1 100 TYR n 1 101 PRO n 1 102 VAL n 1 103 GLU n 1 104 LYS n 1 105 LYS n 1 106 SER n 1 107 SER n 1 108 ALA n 1 109 ARG n 1 110 SER n 1 111 THR n 1 112 GLN n 1 113 GLY n 1 114 THR n 1 115 THR n 1 116 GLY n 1 117 ILE n 1 118 ARG n 1 119 GLU n 1 120 ASP n 1 121 PRO n 1 122 ASP n 1 123 VAL n 1 124 CYS n 1 125 LEU n 1 126 LYS n 1 127 ALA n 1 128 PRO n 2 1 ARG n 2 2 LYS n 2 3 SER n 2 4 LEU n 2 5 THR n 2 6 ILE n 2 7 TYR n 2 8 ALA n 2 9 GLN n 2 10 VAL n 2 11 GLN n 2 12 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET3a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;This peptide was chemically synthesized (solid phase synthesis). The sequence of the peptide is naturally found in Homo sapiens (human). ; # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP SH21A_HUMAN 1 ;MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKI KNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP ; 1 O60880 ? 2 UNP SLAF1_HUMAN 2 KKSLTIYAQVQK 275 Q13291 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1KA7 A 1 ? 128 ? O60880 1 ? 128 ? 1 128 2 2 1KA7 B 1 ? 12 ? Q13291 275 ? 286 ? 275 286 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 1KA7 _struct_ref_seq_dif.mon_id ARG _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q13291 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 275 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 275 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '3D_15N,13C-separated NOESY' 2 1 1 '3D HNHB' 3 1 1 '3D_HN(CO)HB' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '120 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM SAP U-15N, 13C; 1mM n-pY; 20 mM phosphate buffer, 100mM NaCl' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1KA7 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1KA7 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1KA7 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1KA7 _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal ARIA 1.0 'structure solution' Nilges 1 NMRPipe 1.8 processing Delaglio 2 NMRView 3.0 'data analysis' Johnson 3 ARIA 1.0 refinement Nilges 4 # _exptl.entry_id 1KA7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1KA7 _struct.title 'SAP/SH2D1A bound to peptide n-Y-c' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1KA7 _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'SH2 domain, protein-peptide complex, IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 12 ? GLY A 24 ? SER A 12 GLY A 24 1 ? 13 HELX_P HELX_P2 2 LYS A 81 ? GLN A 88 ? LYS A 81 GLN A 88 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 64 ? ALA A 66 ? TRP A 64 ALA A 66 A 2 TYR A 50 ? GLN A 58 ? TYR A 50 GLN A 58 A 3 TYR A 41 ? TYR A 47 ? TYR A 41 TYR A 47 A 4 SER A 28 ? ASP A 33 ? SER A 28 ASP A 33 A 5 TYR A 7 ? GLY A 9 ? TYR A 7 GLY A 9 B 1 TRP A 64 ? ALA A 66 ? TRP A 64 ALA A 66 B 2 TYR A 50 ? GLN A 58 ? TYR A 50 GLN A 58 B 3 TYR A 41 ? TYR A 47 ? TYR A 41 TYR A 47 B 4 SER A 28 ? ASP A 33 ? SER A 28 ASP A 33 B 5 TYR A 100 ? PRO A 101 ? TYR A 100 PRO A 101 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 65 ? O SER A 65 N SER A 57 ? N SER A 57 A 2 3 O VAL A 56 ? O VAL A 56 N TYR A 41 ? N TYR A 41 A 3 4 O CYS A 42 ? O CYS A 42 N ARG A 32 ? N ARG A 32 A 4 5 O ASP A 33 ? O ASP A 33 N GLY A 9 ? N GLY A 9 B 1 2 O SER A 65 ? O SER A 65 N SER A 57 ? N SER A 57 B 2 3 O VAL A 56 ? O VAL A 56 N TYR A 41 ? N TYR A 41 B 3 4 O CYS A 42 ? O CYS A 42 N ARG A 32 ? N ARG A 32 B 4 5 N TYR A 29 ? N TYR A 29 O TYR A 100 ? O TYR A 100 # _database_PDB_matrix.entry_id 1KA7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1KA7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 TRP 64 64 64 TRP TRP A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ALA 108 108 ? ? ? A . n A 1 109 ARG 109 109 ? ? ? A . n A 1 110 SER 110 110 ? ? ? A . n A 1 111 THR 111 111 ? ? ? A . n A 1 112 GLN 112 112 ? ? ? A . n A 1 113 GLY 113 113 ? ? ? A . n A 1 114 THR 114 114 ? ? ? A . n A 1 115 THR 115 115 ? ? ? A . n A 1 116 GLY 116 116 ? ? ? A . n A 1 117 ILE 117 117 ? ? ? A . n A 1 118 ARG 118 118 ? ? ? A . n A 1 119 GLU 119 119 ? ? ? A . n A 1 120 ASP 120 120 ? ? ? A . n A 1 121 PRO 121 121 ? ? ? A . n A 1 122 ASP 122 122 ? ? ? A . n A 1 123 VAL 123 123 ? ? ? A . n A 1 124 CYS 124 124 ? ? ? A . n A 1 125 LEU 125 125 ? ? ? A . n A 1 126 LYS 126 126 ? ? ? A . n A 1 127 ALA 127 127 ? ? ? A . n A 1 128 PRO 128 128 ? ? ? A . n B 2 1 ARG 1 275 275 ARG ARG B . n B 2 2 LYS 2 276 276 LYS LYS B . n B 2 3 SER 3 277 277 SER SER B . n B 2 4 LEU 4 278 278 LEU LEU B . n B 2 5 THR 5 279 279 THR THR B . n B 2 6 ILE 6 280 280 ILE ILE B . n B 2 7 TYR 7 281 281 TYR TYR B . n B 2 8 ALA 8 282 282 ALA ALA B . n B 2 9 GLN 9 283 283 GLN GLN B . n B 2 10 VAL 10 284 284 VAL VAL B . n B 2 11 GLN 11 285 285 GLN GLN B . n B 2 12 LYS 12 286 286 LYS LYS B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-11-07 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? 56.25 70.77 2 1 SER A 36 ? ? -131.94 -31.87 3 1 PRO A 70 ? ? -63.61 91.67 4 1 GLN A 92 ? ? -149.00 20.63 5 1 LEU A 98 ? ? -35.48 133.81 6 1 GLN A 99 ? ? -138.19 -47.55 7 1 LYS A 105 ? ? -166.91 -72.70 8 1 SER B 277 ? ? -161.70 101.38 9 1 LEU B 278 ? ? -106.81 52.34 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 108 ? A ALA 108 2 1 Y 1 A ARG 109 ? A ARG 109 3 1 Y 1 A SER 110 ? A SER 110 4 1 Y 1 A THR 111 ? A THR 111 5 1 Y 1 A GLN 112 ? A GLN 112 6 1 Y 1 A GLY 113 ? A GLY 113 7 1 Y 1 A THR 114 ? A THR 114 8 1 Y 1 A THR 115 ? A THR 115 9 1 Y 1 A GLY 116 ? A GLY 116 10 1 Y 1 A ILE 117 ? A ILE 117 11 1 Y 1 A ARG 118 ? A ARG 118 12 1 Y 1 A GLU 119 ? A GLU 119 13 1 Y 1 A ASP 120 ? A ASP 120 14 1 Y 1 A PRO 121 ? A PRO 121 15 1 Y 1 A ASP 122 ? A ASP 122 16 1 Y 1 A VAL 123 ? A VAL 123 17 1 Y 1 A CYS 124 ? A CYS 124 18 1 Y 1 A LEU 125 ? A LEU 125 19 1 Y 1 A LYS 126 ? A LYS 126 20 1 Y 1 A ALA 127 ? A ALA 127 21 1 Y 1 A PRO 128 ? A PRO 128 #