data_1L6H # _entry.id 1L6H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1L6H RCSB RCSB015685 WWPDB D_1000015685 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1L6H _pdbx_database_status.recvd_initial_deposition_date 2002-03-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Samuel, D.' 1 'Lyu, P.-C.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of plant nonspecific lipid transfer protein-2 from rice (Oryza sativa).' J.Biol.Chem. 277 35267 35273 2002 JBCHA3 US 0021-9258 0071 ? 12011089 10.1074/jbc.M203113200 1 'Purification and characterization of a novel 7-kDa non-specific lipid transfer protein-2 from rice (Oryza sativa)' Biochem.Biophys.Res.Commun. 294 535 540 2002 BBRCA9 US 0006-291X 0146 ? ? '10.1016/S0006-291X(02)00509-0' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Samuel, D.' 1 primary 'Liu, Y.J.' 2 primary 'Cheng, C.S.' 3 primary 'Lyu, P.C.' 4 1 'Liu, Y.-J.' 5 1 'Samuel, D.' 6 1 'Lin, C.-H.' 7 1 'Lyu, P.-C.' 8 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Non-Specific Lipid Transfer Protein' _entity.formula_weight 7017.030 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name LTP2 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH _entity_poly.pdbx_seq_one_letter_code_can AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLY n 1 3 CYS n 1 4 ASN n 1 5 ALA n 1 6 GLY n 1 7 GLN n 1 8 LEU n 1 9 THR n 1 10 VAL n 1 11 CYS n 1 12 THR n 1 13 GLY n 1 14 ALA n 1 15 ILE n 1 16 ALA n 1 17 GLY n 1 18 GLY n 1 19 ALA n 1 20 ARG n 1 21 PRO n 1 22 THR n 1 23 ALA n 1 24 ALA n 1 25 CYS n 1 26 CYS n 1 27 SER n 1 28 SER n 1 29 LEU n 1 30 ARG n 1 31 ALA n 1 32 GLN n 1 33 GLN n 1 34 GLY n 1 35 CYS n 1 36 PHE n 1 37 CYS n 1 38 GLN n 1 39 PHE n 1 40 ALA n 1 41 LYS n 1 42 ASP n 1 43 PRO n 1 44 ARG n 1 45 TYR n 1 46 GLY n 1 47 ARG n 1 48 TYR n 1 49 VAL n 1 50 ASN n 1 51 SER n 1 52 PRO n 1 53 ASN n 1 54 ALA n 1 55 ARG n 1 56 LYS n 1 57 ALA n 1 58 VAL n 1 59 SER n 1 60 SER n 1 61 CYS n 1 62 GLY n 1 63 ILE n 1 64 ALA n 1 65 LEU n 1 66 PRO n 1 67 THR n 1 68 CYS n 1 69 HIS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name rice _entity_src_nat.pdbx_organism_scientific 'Oryza sativa' _entity_src_nat.pdbx_ncbi_taxonomy_id 4530 _entity_src_nat.genus Oryza _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NLTPX_ORYSA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P83210 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1L6H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P83210 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 69 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 69 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 DQF-COSY 2 1 1 '2D NOESY' 3 1 1 TOCSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ? _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1L6H _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structure was based on a total of 862 distance constraints, 813 are NOE-derived distance constrains, 30 diestance restraints from hydrogen bonds, 19 dihedral angle restrains. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1L6H _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1L6H _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XWINNMR 2.1 collection Bruker 1 XWINNMR 2.1 processing Bruker 2 X-PLOR 3.8 'structure solution' Brugner 3 X-PLOR 3.8 refinement Brugner 4 # _exptl.entry_id 1L6H _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1L6H _struct.title 'Solution Structure of Plant nsLTP2 purified from Rice (oryza Sativa)' _struct.pdbx_descriptor 'nonspeciffic lipid-transfer protein 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1L6H _struct_keywords.pdbx_keywords 'LIPID TRANSPORT' _struct_keywords.text 'nsLTP2, Plant LTP, lipid transfer, LIPID TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 7 ? ALA A 16 ? GLN A 7 ALA A 16 1 ? 10 HELX_P HELX_P2 2 THR A 22 ? ALA A 40 ? THR A 22 ALA A 40 1 ? 19 HELX_P HELX_P3 3 ARG A 44 ? VAL A 49 ? ARG A 44 VAL A 49 1 ? 6 HELX_P HELX_P4 4 ASN A 53 ? ALA A 57 ? ASN A 53 ALA A 57 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 3 A CYS 35 1_555 ? ? ? ? ? ? ? 2.018 ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 11 A CYS 25 1_555 ? ? ? ? ? ? ? 2.035 ? disulf3 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 61 SG ? ? A CYS 26 A CYS 61 1_555 ? ? ? ? ? ? ? 2.041 ? disulf4 disulf ? ? A CYS 37 SG ? ? ? 1_555 A CYS 68 SG ? ? A CYS 37 A CYS 68 1_555 ? ? ? ? ? ? ? 2.046 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1L6H _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1L6H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 HIS 69 69 69 HIS HIS A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-10-02 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 11 ? ? CB A CYS 11 ? ? SG A CYS 11 ? ? 121.99 114.20 7.79 1.10 N 2 1 CB A ALA 40 ? ? CA A ALA 40 ? ? C A ALA 40 ? ? 101.01 110.10 -9.09 1.50 N 3 1 CA A CYS 61 ? ? CB A CYS 61 ? ? SG A CYS 61 ? ? 121.40 114.20 7.20 1.10 N 4 1 CA A CYS 68 ? ? CB A CYS 68 ? ? SG A CYS 68 ? ? 129.59 114.20 15.39 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 3 ? ? -163.55 35.73 2 1 THR A 9 ? ? -36.42 -37.90 3 1 CYS A 11 ? ? -67.26 14.04 4 1 ALA A 19 ? ? -63.01 94.35 5 1 ARG A 44 ? ? -145.01 -3.09 6 1 TYR A 48 ? ? -86.66 -75.93 7 1 SER A 51 ? ? -147.50 -82.36 8 1 ASN A 53 ? ? -135.15 -33.43 9 1 ALA A 57 ? ? -159.86 70.28 10 1 SER A 59 ? ? 112.04 -112.44 11 1 SER A 60 ? ? 99.27 55.66 12 1 ALA A 64 ? ? 143.56 -24.02 13 1 LEU A 65 ? ? 76.66 67.46 14 1 PRO A 66 ? ? -68.27 29.87 15 1 CYS A 68 ? ? -85.62 41.68 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ASN A 50 ? ? SER A 51 ? ? 128.89 2 1 SER A 51 ? ? PRO A 52 ? ? -136.39 3 1 SER A 59 ? ? SER A 60 ? ? -136.52 4 1 ILE A 63 ? ? ALA A 64 ? ? 122.14 5 1 ALA A 64 ? ? LEU A 65 ? ? -147.28 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 PHE A 39 ? ? 0.080 'SIDE CHAIN' 2 1 TYR A 45 ? ? 0.133 'SIDE CHAIN' #