data_1LWK # _entry.id 1LWK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LWK pdb_00001lwk 10.2210/pdb1lwk/pdb RCSB RCSB016349 ? ? WWPDB D_1000016349 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1LW9 'T4 lysozyme with mutations C54T/C97A' unspecified PDB 1LWG 'T4 lysozyme with mutations C54T/L84M/V87M/L91M/C97A/L99M/V111M/L118M/L121M/L133M' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LWK _pdbx_database_status.recvd_initial_deposition_date 2002-05-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gassner, N.C.' 1 'Baase, W.A.' 2 'Mooers, B.H.M.' 3 'Busam, R.D.' 4 'Weaver, L.H.' 5 'Lindstrom, J.D.' 6 'Quillin, M.L.' 7 'Matthews, B.M.' 8 # _citation.id primary _citation.title 'Multiple methionine substitutions are tolerated in T4 lysozyme and have coupled effects on folding and stability.' _citation.journal_abbrev Biophys.Chem. _citation.journal_volume 100 _citation.page_first 325 _citation.page_last 340 _citation.year 2003 _citation.journal_id_ASTM BICIAZ _citation.country NE _citation.journal_id_ISSN 0301-4622 _citation.journal_id_CSD 0829 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12646375 _citation.pdbx_database_id_DOI '10.1016/S0301-4622(02)00290-9' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gassner, N.C.' 1 ? primary 'Baase, W.A.' 2 ? primary 'Mooers, B.H.' 3 ? primary 'Busam, R.D.' 4 ? primary 'Weaver, L.H.' 5 ? primary 'Lindstrom, J.D.' 6 ? primary 'Quillin, M.L.' 7 ? primary 'Matthews, B.W.' 8 ? # _cell.entry_id 1LWK _cell.length_a 60.332 _cell.length_b 60.332 _cell.length_c 91.367 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1LWK _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Lysozyme 19541.418 1 3.2.1.17 C54T,L84MSE,V87MSE,L91MSE,C97A,L99MSE,G110R,V111MSE,L118MSE,L121MSE,L133MSE,F153MSE ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 3 non-polymer syn '2-HYDROXYETHYL DISULFIDE' 154.251 1 ? ? ? ? 4 water nat water 18.015 77 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lysis protein, Muramidase, Endolysin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)NIFE(MSE)LRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVD AAVRGILRNAK(MSE)KP(MSE)YDS(MSE)DAVRRAA(MSE)IN(MSE)VFQ(MSE)GETR(MSE)AGFTNS(MSE)R (MSE)(MSE)QQKRWDEAAVN(MSE)AKSRWYNQTPNRAKRVITT(MSE)RTGTWDAYKNL ; _entity_poly.pdbx_seq_one_letter_code_can ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR NAKMKPMYDSMDAVRRAAMINMVFQMGETRMAGFTNSMRMMQQKRWDEAAVNMAKSRWYNQTPNRAKRVITTMRTGTWDA YKNL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASN n 1 3 ILE n 1 4 PHE n 1 5 GLU n 1 6 MSE n 1 7 LEU n 1 8 ARG n 1 9 ILE n 1 10 ASP n 1 11 GLU n 1 12 GLY n 1 13 LEU n 1 14 ARG n 1 15 LEU n 1 16 LYS n 1 17 ILE n 1 18 TYR n 1 19 LYS n 1 20 ASP n 1 21 THR n 1 22 GLU n 1 23 GLY n 1 24 TYR n 1 25 TYR n 1 26 THR n 1 27 ILE n 1 28 GLY n 1 29 ILE n 1 30 GLY n 1 31 HIS n 1 32 LEU n 1 33 LEU n 1 34 THR n 1 35 LYS n 1 36 SER n 1 37 PRO n 1 38 SER n 1 39 LEU n 1 40 ASN n 1 41 ALA n 1 42 ALA n 1 43 LYS n 1 44 SER n 1 45 GLU n 1 46 LEU n 1 47 ASP n 1 48 LYS n 1 49 ALA n 1 50 ILE n 1 51 GLY n 1 52 ARG n 1 53 ASN n 1 54 THR n 1 55 ASN n 1 56 GLY n 1 57 VAL n 1 58 ILE n 1 59 THR n 1 60 LYS n 1 61 ASP n 1 62 GLU n 1 63 ALA n 1 64 GLU n 1 65 LYS n 1 66 LEU n 1 67 PHE n 1 68 ASN n 1 69 GLN n 1 70 ASP n 1 71 VAL n 1 72 ASP n 1 73 ALA n 1 74 ALA n 1 75 VAL n 1 76 ARG n 1 77 GLY n 1 78 ILE n 1 79 LEU n 1 80 ARG n 1 81 ASN n 1 82 ALA n 1 83 LYS n 1 84 MSE n 1 85 LYS n 1 86 PRO n 1 87 MSE n 1 88 TYR n 1 89 ASP n 1 90 SER n 1 91 MSE n 1 92 ASP n 1 93 ALA n 1 94 VAL n 1 95 ARG n 1 96 ARG n 1 97 ALA n 1 98 ALA n 1 99 MSE n 1 100 ILE n 1 101 ASN n 1 102 MSE n 1 103 VAL n 1 104 PHE n 1 105 GLN n 1 106 MSE n 1 107 GLY n 1 108 GLU n 1 109 THR n 1 110 ARG n 1 111 MSE n 1 112 ALA n 1 113 GLY n 1 114 PHE n 1 115 THR n 1 116 ASN n 1 117 SER n 1 118 MSE n 1 119 ARG n 1 120 MSE n 1 121 MSE n 1 122 GLN n 1 123 GLN n 1 124 LYS n 1 125 ARG n 1 126 TRP n 1 127 ASP n 1 128 GLU n 1 129 ALA n 1 130 ALA n 1 131 VAL n 1 132 ASN n 1 133 MSE n 1 134 ALA n 1 135 LYS n 1 136 SER n 1 137 ARG n 1 138 TRP n 1 139 TYR n 1 140 ASN n 1 141 GLN n 1 142 THR n 1 143 PRO n 1 144 ASN n 1 145 ARG n 1 146 ALA n 1 147 LYS n 1 148 ARG n 1 149 VAL n 1 150 ILE n 1 151 THR n 1 152 THR n 1 153 MSE n 1 154 ARG n 1 155 THR n 1 156 GLY n 1 157 THR n 1 158 TRP n 1 159 ASP n 1 160 ALA n 1 161 TYR n 1 162 LYS n 1 163 ASN n 1 164 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'T4-like viruses' _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Enterobacteria phage T4 sensu lato' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage T4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10665 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYS_BPT4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YKNL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P00720 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LWK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 164 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00720 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 164 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1LWK MSE A 1 ? UNP P00720 MET 1 'modified residue' 1 1 1 1LWK MSE A 6 ? UNP P00720 MET 6 'modified residue' 6 2 1 1LWK THR A 54 ? UNP P00720 CYS 54 'engineered mutation' 54 3 1 1LWK MSE A 84 ? UNP P00720 LEU 84 'engineered mutation' 84 4 1 1LWK MSE A 87 ? UNP P00720 VAL 87 'engineered mutation' 87 5 1 1LWK MSE A 91 ? UNP P00720 LEU 91 'engineered mutation' 91 6 1 1LWK ALA A 97 ? UNP P00720 CYS 97 'engineered mutation' 97 7 1 1LWK MSE A 99 ? UNP P00720 LEU 99 'engineered mutation' 99 8 1 1LWK MSE A 102 ? UNP P00720 MET 102 'modified residue' 102 9 1 1LWK MSE A 106 ? UNP P00720 MET 106 'modified residue' 106 10 1 1LWK ARG A 110 ? UNP P00720 GLY 110 'engineered mutation' 110 11 1 1LWK MSE A 111 ? UNP P00720 VAL 111 'engineered mutation' 111 12 1 1LWK MSE A 118 ? UNP P00720 LEU 118 'engineered mutation' 118 13 1 1LWK MSE A 120 ? UNP P00720 MET 120 'modified residue' 120 14 1 1LWK MSE A 121 ? UNP P00720 LEU 121 'engineered mutation' 121 15 1 1LWK MSE A 133 ? UNP P00720 LEU 133 'engineered mutation' 133 16 1 1LWK MSE A 153 ? UNP P00720 PHE 153 'engineered mutation' 153 17 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HED non-polymer . '2-HYDROXYETHYL DISULFIDE' ? 'C4 H10 O2 S2' 154.251 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1LWK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 49.92 _exptl_crystal.density_Matthews 2.46 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_details 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 173 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2002-02-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.82653 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL9-1' _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL9-1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.82653 # _reflns.entry_id 1LWK _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 60 _reflns.number_all 11728 _reflns.number_obs 11279 _reflns.percent_possible_obs 99.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.18 _reflns_shell.percent_possible_all 99.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1LWK _refine.ls_d_res_high 2.1 _refine.ls_d_res_low 60 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 11279 _refine.ls_number_reflns_obs 11279 _refine.ls_number_reflns_R_free ? _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all 0.219 _refine.ls_R_factor_obs 0.219 _refine.ls_R_factor_R_work 0.217 _refine.ls_R_factor_R_free ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1L63 _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 0.06 _refine.aniso_B[1][2] 0.06 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.06 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.12 _refine.details 'Residues ASN 163 and LEU 164 are missing in the electron density.' _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1298 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 78 _refine_hist.number_atoms_total 1386 _refine_hist.d_res_high 2.1 _refine_hist.d_res_low 60 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_angle_deg 2.9 ? ? ? 'X-RAY DIFFRACTION' ? t_bond_d 0.018 ? ? ? 'X-RAY DIFFRACTION' ? t_dihedral_angle_d 19.823 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1LWK _struct.title 'Multiple Methionine Substitutions are Tolerated in T4 Lysozyme and have Coupled Effects on Folding and Stability' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LWK _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'hydrolase (o-glycosyl), T4 lysozyme, methionine core mutant, protein engineering, protein folding, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 2 ? GLY A 12 ? ASN A 2 GLY A 12 1 ? 11 HELX_P HELX_P2 2 SER A 38 ? GLY A 51 ? SER A 38 GLY A 51 1 ? 14 HELX_P HELX_P3 3 THR A 59 ? ARG A 80 ? THR A 59 ARG A 80 1 ? 22 HELX_P HELX_P4 4 LYS A 83 ? MSE A 91 ? LYS A 83 MSE A 91 1 ? 9 HELX_P HELX_P5 5 ASP A 92 ? GLY A 107 ? ASP A 92 GLY A 107 1 ? 16 HELX_P HELX_P6 6 GLY A 107 ? ALA A 112 ? GLY A 107 ALA A 112 1 ? 6 HELX_P HELX_P7 7 PHE A 114 ? GLN A 123 ? PHE A 114 GLN A 123 1 ? 10 HELX_P HELX_P8 8 ARG A 125 ? LYS A 135 ? ARG A 125 LYS A 135 1 ? 11 HELX_P HELX_P9 9 SER A 136 ? THR A 142 ? SER A 136 THR A 142 1 ? 7 HELX_P HELX_P10 10 THR A 142 ? GLY A 156 ? THR A 142 GLY A 156 1 ? 15 HELX_P HELX_P11 11 TRP A 158 ? LYS A 162 ? TRP A 158 LYS A 162 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A ASN 2 N ? ? A MSE 1 A ASN 2 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A GLU 5 C ? ? ? 1_555 A MSE 6 N ? ? A GLU 5 A MSE 6 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale3 covale both ? A MSE 6 C ? ? ? 1_555 A LEU 7 N ? ? A MSE 6 A LEU 7 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A LYS 83 C ? ? ? 1_555 A MSE 84 N ? ? A LYS 83 A MSE 84 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale5 covale both ? A MSE 84 C ? ? ? 1_555 A LYS 85 N ? ? A MSE 84 A LYS 85 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale6 covale both ? A PRO 86 C ? ? ? 1_555 A MSE 87 N ? ? A PRO 86 A MSE 87 1_555 ? ? ? ? ? ? ? 1.308 ? ? covale7 covale both ? A MSE 87 C ? ? ? 1_555 A TYR 88 N ? ? A MSE 87 A TYR 88 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale8 covale both ? A SER 90 C ? ? ? 1_555 A MSE 91 N ? ? A SER 90 A MSE 91 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale9 covale both ? A MSE 91 C ? ? ? 1_555 A ASP 92 N ? ? A MSE 91 A ASP 92 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale10 covale both ? A ALA 98 C ? ? ? 1_555 A MSE 99 N ? ? A ALA 98 A MSE 99 1_555 ? ? ? ? ? ? ? 1.356 ? ? covale11 covale both ? A MSE 99 C ? ? ? 1_555 A ILE 100 N ? ? A MSE 99 A ILE 100 1_555 ? ? ? ? ? ? ? 1.373 ? ? covale12 covale both ? A ASN 101 C ? ? ? 1_555 A MSE 102 N ? ? A ASN 101 A MSE 102 1_555 ? ? ? ? ? ? ? 1.365 ? ? covale13 covale both ? A MSE 102 C ? ? ? 1_555 A VAL 103 N ? ? A MSE 102 A VAL 103 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale14 covale both ? A GLN 105 C ? ? ? 1_555 A MSE 106 N ? ? A GLN 105 A MSE 106 1_555 ? ? ? ? ? ? ? 1.314 ? ? covale15 covale both ? A MSE 106 C ? ? ? 1_555 A GLY 107 N ? ? A MSE 106 A GLY 107 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale16 covale both ? A ARG 110 C ? ? ? 1_555 A MSE 111 N ? ? A ARG 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.312 ? ? covale17 covale both ? A MSE 111 C ? ? ? 1_555 A ALA 112 N ? ? A MSE 111 A ALA 112 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale18 covale both ? A SER 117 C ? ? ? 1_555 A MSE 118 N ? ? A SER 117 A MSE 118 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale19 covale both ? A MSE 118 C ? ? ? 1_555 A ARG 119 N ? ? A MSE 118 A ARG 119 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale20 covale both ? A ARG 119 C ? ? ? 1_555 A MSE 120 N ? ? A ARG 119 A MSE 120 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale21 covale both ? A MSE 120 C ? ? ? 1_555 A MSE 121 N ? ? A MSE 120 A MSE 121 1_555 ? ? ? ? ? ? ? 1.316 ? ? covale22 covale both ? A MSE 121 C ? ? ? 1_555 A GLN 122 N ? ? A MSE 121 A GLN 122 1_555 ? ? ? ? ? ? ? 1.284 ? ? covale23 covale both ? A ASN 132 C ? ? ? 1_555 A MSE 133 N ? ? A ASN 132 A MSE 133 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale24 covale both ? A MSE 133 C ? ? ? 1_555 A ALA 134 N ? ? A MSE 133 A ALA 134 1_555 ? ? ? ? ? ? ? 1.349 ? ? covale25 covale both ? A THR 152 C ? ? ? 1_555 A MSE 153 N ? ? A THR 152 A MSE 153 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale26 covale both ? A MSE 153 C ? ? ? 1_555 A ARG 154 N ? ? A MSE 153 A ARG 154 1_555 ? ? ? ? ? ? ? 1.288 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 18 ? LYS A 19 ? TYR A 18 LYS A 19 A 2 TYR A 25 ? ILE A 27 ? TYR A 25 ILE A 27 A 3 HIS A 31 ? THR A 34 ? HIS A 31 THR A 34 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 18 ? N TYR A 18 O THR A 26 ? O THR A 26 A 2 3 N TYR A 25 ? N TYR A 25 O LEU A 33 ? O LEU A 33 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 167 ? 4 'BINDING SITE FOR RESIDUE CL A 167' AC2 Software A CL 228 ? 4 'BINDING SITE FOR RESIDUE CL A 228' AC3 Software A HED 901 ? 5 'BINDING SITE FOR RESIDUE HED A 901' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLN A 69 ? GLN A 69 . ? 2_654 ? 2 AC1 4 ALA A 93 ? ALA A 93 . ? 4_655 ? 3 AC1 4 ASN A 140 ? ASN A 140 . ? 1_555 ? 4 AC1 4 GLN A 141 ? GLN A 141 . ? 1_555 ? 5 AC2 4 LYS A 65 ? LYS A 65 . ? 5_555 ? 6 AC2 4 ASN A 68 ? ASN A 68 . ? 5_555 ? 7 AC2 4 VAL A 94 ? VAL A 94 . ? 1_555 ? 8 AC2 4 TRP A 158 ? TRP A 158 . ? 1_555 ? 9 AC3 5 ASN A 68 ? ASN A 68 . ? 1_555 ? 10 AC3 5 VAL A 75 ? VAL A 75 . ? 5_555 ? 11 AC3 5 TYR A 88 ? TYR A 88 . ? 5_555 ? 12 AC3 5 ALA A 93 ? ALA A 93 . ? 5_555 ? 13 AC3 5 HOH E . ? HOH A 209 . ? 1_555 ? # _database_PDB_matrix.entry_id 1LWK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1LWK _atom_sites.fract_transf_matrix[1][1] 0.016575 _atom_sites.fract_transf_matrix[1][2] 0.009570 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019139 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010945 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 MSE 6 6 6 MSE MSE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 MSE 84 84 84 MSE MSE A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 MSE 87 87 87 MSE MSE A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 MSE 91 91 91 MSE MSE A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 MSE 99 99 99 MSE MSE A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 MSE 102 102 102 MSE MSE A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 MSE 106 106 106 MSE MSE A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 MSE 111 111 111 MSE MSE A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 MSE 118 118 118 MSE MSE A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 MSE 120 120 120 MSE MSE A . n A 1 121 MSE 121 121 121 MSE MSE A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 MSE 133 133 133 MSE MSE A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 MSE 153 153 153 MSE MSE A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 TRP 158 158 158 TRP TRP A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 ASN 163 163 ? ? ? A . n A 1 164 LEU 164 164 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 167 167 CL CL A . C 2 CL 1 228 228 CL CL A . D 3 HED 1 901 901 HED HED A . E 4 HOH 1 168 168 HOH HOH A . E 4 HOH 2 169 169 HOH HOH A . E 4 HOH 3 170 170 HOH HOH A . E 4 HOH 4 171 171 HOH HOH A . E 4 HOH 5 172 172 HOH HOH A . E 4 HOH 6 173 173 HOH HOH A . E 4 HOH 7 174 174 HOH HOH A . E 4 HOH 8 181 181 HOH HOH A . E 4 HOH 9 182 182 HOH HOH A . E 4 HOH 10 185 185 HOH HOH A . E 4 HOH 11 187 187 HOH HOH A . E 4 HOH 12 189 189 HOH HOH A . E 4 HOH 13 191 191 HOH HOH A . E 4 HOH 14 195 195 HOH HOH A . E 4 HOH 15 196 196 HOH HOH A . E 4 HOH 16 197 197 HOH HOH A . E 4 HOH 17 198 198 HOH HOH A . E 4 HOH 18 204 204 HOH HOH A . E 4 HOH 19 205 205 HOH HOH A . E 4 HOH 20 206 206 HOH HOH A . E 4 HOH 21 207 207 HOH HOH A . E 4 HOH 22 208 208 HOH HOH A . E 4 HOH 23 209 209 HOH HOH A . E 4 HOH 24 212 212 HOH HOH A . E 4 HOH 25 215 215 HOH HOH A . E 4 HOH 26 219 219 HOH HOH A . E 4 HOH 27 227 227 HOH HOH A . E 4 HOH 28 230 230 HOH HOH A . E 4 HOH 29 231 231 HOH HOH A . E 4 HOH 30 232 232 HOH HOH A . E 4 HOH 31 233 233 HOH HOH A . E 4 HOH 32 234 234 HOH HOH A . E 4 HOH 33 237 237 HOH HOH A . E 4 HOH 34 238 238 HOH HOH A . E 4 HOH 35 239 239 HOH HOH A . E 4 HOH 36 241 241 HOH HOH A . E 4 HOH 37 243 243 HOH HOH A . E 4 HOH 38 246 246 HOH HOH A . E 4 HOH 39 247 247 HOH HOH A . E 4 HOH 40 248 248 HOH HOH A . E 4 HOH 41 249 249 HOH HOH A . E 4 HOH 42 251 251 HOH HOH A . E 4 HOH 43 252 252 HOH HOH A . E 4 HOH 44 253 253 HOH HOH A . E 4 HOH 45 257 257 HOH HOH A . E 4 HOH 46 260 260 HOH HOH A . E 4 HOH 47 261 261 HOH HOH A . E 4 HOH 48 262 262 HOH HOH A . E 4 HOH 49 263 263 HOH HOH A . E 4 HOH 50 264 264 HOH HOH A . E 4 HOH 51 265 265 HOH HOH A . E 4 HOH 52 274 274 HOH HOH A . E 4 HOH 53 276 276 HOH HOH A . E 4 HOH 54 277 277 HOH HOH A . E 4 HOH 55 279 279 HOH HOH A . E 4 HOH 56 282 282 HOH HOH A . E 4 HOH 57 283 283 HOH HOH A . E 4 HOH 58 284 284 HOH HOH A . E 4 HOH 59 285 285 HOH HOH A . E 4 HOH 60 288 288 HOH HOH A . E 4 HOH 61 289 289 HOH HOH A . E 4 HOH 62 304 304 HOH HOH A . E 4 HOH 63 305 305 HOH HOH A . E 4 HOH 64 306 306 HOH HOH A . E 4 HOH 65 307 307 HOH HOH A . E 4 HOH 66 308 308 HOH HOH A . E 4 HOH 67 309 309 HOH HOH A . E 4 HOH 68 316 316 HOH HOH A . E 4 HOH 69 323 323 HOH HOH A . E 4 HOH 70 325 325 HOH HOH A . E 4 HOH 71 331 331 HOH HOH A . E 4 HOH 72 333 333 HOH HOH A . E 4 HOH 73 336 336 HOH HOH A . E 4 HOH 74 340 340 HOH HOH A . E 4 HOH 75 344 344 HOH HOH A . E 4 HOH 76 356 356 HOH HOH A . E 4 HOH 77 357 357 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 6 A MSE 6 ? MET SELENOMETHIONINE 3 A MSE 84 A MSE 84 ? MET SELENOMETHIONINE 4 A MSE 87 A MSE 87 ? MET SELENOMETHIONINE 5 A MSE 91 A MSE 91 ? MET SELENOMETHIONINE 6 A MSE 99 A MSE 99 ? MET SELENOMETHIONINE 7 A MSE 102 A MSE 102 ? MET SELENOMETHIONINE 8 A MSE 106 A MSE 106 ? MET SELENOMETHIONINE 9 A MSE 111 A MSE 111 ? MET SELENOMETHIONINE 10 A MSE 118 A MSE 118 ? MET SELENOMETHIONINE 11 A MSE 120 A MSE 120 ? MET SELENOMETHIONINE 12 A MSE 121 A MSE 121 ? MET SELENOMETHIONINE 13 A MSE 133 A MSE 133 ? MET SELENOMETHIONINE 14 A MSE 153 A MSE 153 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-05-20 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-03-14 5 'Structure model' 1 4 2019-07-24 6 'Structure model' 1 5 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Refinement description' 7 6 'Structure model' 'Database references' 8 6 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' struct_ref_seq_dif 2 5 'Structure model' software 3 5 'Structure model' struct_conn 4 6 'Structure model' database_2 5 6 'Structure model' struct_ref_seq_dif 6 6 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_struct_ref_seq_dif.details' 2 5 'Structure model' '_software.classification' 3 5 'Structure model' '_software.name' 4 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 6 'Structure model' '_database_2.pdbx_DOI' 6 6 'Structure model' '_database_2.pdbx_database_accession' 7 6 'Structure model' '_struct_ref_seq_dif.details' 8 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 9 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 10 6 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal TNT refinement . ? 1 SCALA 'data scaling' . ? 2 XTALVIEW refinement . ? 3 MOSFLM 'data reduction' . ? 4 CCP4 'data scaling' '(SCALA)' ? 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O6 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HED _pdbx_validate_symm_contact.auth_seq_id_1 901 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O6 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HED _pdbx_validate_symm_contact.auth_seq_id_2 901 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_555 _pdbx_validate_symm_contact.dist 1.78 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.341 1.252 0.089 0.011 N 2 1 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.320 1.252 0.068 0.011 N 3 1 CD A GLU 45 ? ? OE2 A GLU 45 ? ? 1.322 1.252 0.070 0.011 N 4 1 CD A GLU 62 ? ? OE2 A GLU 62 ? ? 1.349 1.252 0.097 0.011 N 5 1 CD A GLU 108 ? ? OE2 A GLU 108 ? ? 1.328 1.252 0.076 0.011 N 6 1 CD A GLU 128 ? ? OE2 A GLU 128 ? ? 1.335 1.252 0.083 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.82 120.30 4.52 0.50 N 2 1 CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 126.16 118.30 7.86 0.90 N 3 1 CB A ASP 20 ? ? CG A ASP 20 ? ? OD2 A ASP 20 ? ? 110.67 118.30 -7.63 0.90 N 4 1 CB A ASP 47 ? ? CG A ASP 47 ? ? OD1 A ASP 47 ? ? 126.53 118.30 8.23 0.90 N 5 1 CB A ASP 47 ? ? CG A ASP 47 ? ? OD2 A ASP 47 ? ? 109.50 118.30 -8.80 0.90 N 6 1 CB A ASP 61 ? ? CG A ASP 61 ? ? OD1 A ASP 61 ? ? 125.58 118.30 7.28 0.90 N 7 1 CB A ASP 61 ? ? CG A ASP 61 ? ? OD2 A ASP 61 ? ? 109.70 118.30 -8.60 0.90 N 8 1 CB A ASP 92 ? ? CG A ASP 92 ? ? OD1 A ASP 92 ? ? 127.72 118.30 9.42 0.90 N 9 1 CB A ASP 92 ? ? CG A ASP 92 ? ? OD2 A ASP 92 ? ? 111.90 118.30 -6.40 0.90 N 10 1 CA A VAL 94 ? ? CB A VAL 94 ? ? CG2 A VAL 94 ? ? 99.93 110.90 -10.97 1.50 N 11 1 CD A ARG 95 ? ? NE A ARG 95 ? ? CZ A ARG 95 ? ? 136.80 123.60 13.20 1.40 N 12 1 NE A ARG 95 ? ? CZ A ARG 95 ? ? NH1 A ARG 95 ? ? 116.78 120.30 -3.52 0.50 N 13 1 NE A ARG 95 ? ? CZ A ARG 95 ? ? NH2 A ARG 95 ? ? 127.08 120.30 6.78 0.50 N 14 1 NE A ARG 119 ? ? CZ A ARG 119 ? ? NH1 A ARG 119 ? ? 124.28 120.30 3.98 0.50 N 15 1 NE A ARG 154 ? ? CZ A ARG 154 ? ? NH1 A ARG 154 ? ? 123.33 120.30 3.03 0.50 N 16 1 CB A ASP 159 ? ? CG A ASP 159 ? ? OD2 A ASP 159 ? ? 112.66 118.30 -5.64 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 36 ? ? -175.08 125.70 2 1 ARG A 125 ? ? -92.25 53.90 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 163 ? A ASN 163 2 1 Y 1 A LEU 164 ? A LEU 164 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 '2-HYDROXYETHYL DISULFIDE' HED 4 water HOH #