data_1MC2 # _entry.id 1MC2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.290 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1MC2 RCSB RCSB016812 WWPDB D_1000016812 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1MC2 _pdbx_database_status.recvd_initial_deposition_date 2002-08-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, Q.' 1 'Huang, Q.Q.' 2 'Zhang, R.G.' 3 'Weeks, C.M.' 4 'Jelsch, C.' 5 'Teng, M.K.' 6 'Niu, L.W.' 7 # _citation.id primary _citation.title ;The crystal structure of a novel, inactive, lysine 49 PLA2 from Agkistrodon acutus venom: an ultrahigh resolution, AB initio structure determination ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 41400 _citation.page_last 41408 _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12871974 _citation.pdbx_database_id_DOI 10.1074/jbc.M305210200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Liu, Q.' 1 primary 'Huang, Q.Q.' 2 primary 'Teng, M.K.' 3 primary 'Weeks, C.M.' 4 primary 'Jelsch, C.' 5 primary 'Zhang, R.G.' 6 primary 'Niu, L.W.' 7 # _cell.entry_id 1MC2 _cell.length_a 44.732 _cell.length_b 59.086 _cell.length_c 45.308 _cell.angle_alpha 90.00 _cell.angle_beta 117.43 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1MC2 _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat Acutohaemonlysin 14093.383 1 ? ? ? ? 2 non-polymer syn 'ISOPROPYL ALCOHOL' 60.095 2 ? ? ? ? 3 water nat water 18.015 228 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'phospholipase a2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SLFELGKMIWQETGKNPVKNYGLYGCNCGVGGRGEPLDATDRCCFVHKCCYKKLTDCDSKKDRYSYKWKNKAIVCGKNQP CMQEMCECDKAFAICLRENLDTYNKSFRYHLKPSCKKTSEQC ; _entity_poly.pdbx_seq_one_letter_code_can ;SLFELGKMIWQETGKNPVKNYGLYGCNCGVGGRGEPLDATDRCCFVHKCCYKKLTDCDSKKDRYSYKWKNKAIVCGKNQP CMQEMCECDKAFAICLRENLDTYNKSFRYHLKPSCKKTSEQC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 PHE n 1 4 GLU n 1 5 LEU n 1 6 GLY n 1 7 LYS n 1 8 MET n 1 9 ILE n 1 10 TRP n 1 11 GLN n 1 12 GLU n 1 13 THR n 1 14 GLY n 1 15 LYS n 1 16 ASN n 1 17 PRO n 1 18 VAL n 1 19 LYS n 1 20 ASN n 1 21 TYR n 1 22 GLY n 1 23 LEU n 1 24 TYR n 1 25 GLY n 1 26 CYS n 1 27 ASN n 1 28 CYS n 1 29 GLY n 1 30 VAL n 1 31 GLY n 1 32 GLY n 1 33 ARG n 1 34 GLY n 1 35 GLU n 1 36 PRO n 1 37 LEU n 1 38 ASP n 1 39 ALA n 1 40 THR n 1 41 ASP n 1 42 ARG n 1 43 CYS n 1 44 CYS n 1 45 PHE n 1 46 VAL n 1 47 HIS n 1 48 LYS n 1 49 CYS n 1 50 CYS n 1 51 TYR n 1 52 LYS n 1 53 LYS n 1 54 LEU n 1 55 THR n 1 56 ASP n 1 57 CYS n 1 58 ASP n 1 59 SER n 1 60 LYS n 1 61 LYS n 1 62 ASP n 1 63 ARG n 1 64 TYR n 1 65 SER n 1 66 TYR n 1 67 LYS n 1 68 TRP n 1 69 LYS n 1 70 ASN n 1 71 LYS n 1 72 ALA n 1 73 ILE n 1 74 VAL n 1 75 CYS n 1 76 GLY n 1 77 LYS n 1 78 ASN n 1 79 GLN n 1 80 PRO n 1 81 CYS n 1 82 MET n 1 83 GLN n 1 84 GLU n 1 85 MET n 1 86 CYS n 1 87 GLU n 1 88 CYS n 1 89 ASP n 1 90 LYS n 1 91 ALA n 1 92 PHE n 1 93 ALA n 1 94 ILE n 1 95 CYS n 1 96 LEU n 1 97 ARG n 1 98 GLU n 1 99 ASN n 1 100 LEU n 1 101 ASP n 1 102 THR n 1 103 TYR n 1 104 ASN n 1 105 LYS n 1 106 SER n 1 107 PHE n 1 108 ARG n 1 109 TYR n 1 110 HIS n 1 111 LEU n 1 112 LYS n 1 113 PRO n 1 114 SER n 1 115 CYS n 1 116 LYS n 1 117 LYS n 1 118 THR n 1 119 SER n 1 120 GLU n 1 121 GLN n 1 122 CYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Chinese moccasin' _entity_src_nat.pdbx_organism_scientific 'Deinagkistrodon acutus' _entity_src_nat.pdbx_ncbi_taxonomy_id 36307 _entity_src_nat.genus Deinagkistrodon _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PA2H_AGKAC _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SLFELGKMIWQETGKNPVKNYGLYGCNCGVGGRGEPLDATDRCCFVHKCCYKKLTDCDSKKDRYSYKWKNKAIVCGKNQP CMQEMCECDKAFAICLRENLDTYNKSFRYHLKPSCKKTSEQC ; _struct_ref.pdbx_align_begin 17 _struct_ref.pdbx_db_accession O57385 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1MC2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O57385 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1001 _struct_ref_seq.pdbx_auth_seq_align_end 1134 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPA non-polymer . 'ISOPROPYL ALCOHOL' 2-PROPANOL 'C3 H8 O' 60.095 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1MC2 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.45 _exptl_crystal.density_percent_sol 15.3 _exptl_crystal.description ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.8 _exptl_crystal_grow.pdbx_details 'PEG4000, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 1999-11-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator monochromator _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.90 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 17-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 17-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.90 # _reflns.entry_id 1MC2 _reflns.observed_criterion_sigma_I 1.5 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 10.0 _reflns.d_resolution_high 0.85 _reflns.number_obs 73203 _reflns.number_all 155596 _reflns.percent_possible_obs 79.9 _reflns.pdbx_Rmerge_I_obs 0.03 _reflns.pdbx_Rsym_value 0.027 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 0.80 _reflns_shell.d_res_low 0.83 _reflns_shell.percent_possible_all 30 _reflns_shell.Rmerge_I_obs 0.302 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 0.332 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1MC2 _refine.ls_number_reflns_obs 73203 _refine.ls_number_reflns_all 73203 _refine.pdbx_ls_sigma_I 4.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 10.00 _refine.ls_d_res_high 0.85 _refine.ls_percent_reflns_obs 79.9 _refine.ls_R_factor_obs 0.0949 _refine.ls_R_factor_all 0.1043 _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free 0.121 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 3360 _refine.ls_number_parameters 11281 _refine.ls_number_restraints 13526 _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'MOEWS & KRETSINGER, J.MOL.BIOL.91(1973)201-228' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'ANISOTROPIC REFINEMENT REDUCED FREE R (NO CUTOFF) BY 5.12% (include all data)' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'AB INITIO' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENGH AND HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1MC2 _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues 10 _refine_analyze.occupancy_sum_hydrogen 945.00 _refine_analyze.occupancy_sum_non_hydrogen 1210.00 _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2019 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 236 _refine_hist.number_atoms_total 2255 _refine_hist.d_res_high 0.85 _refine_hist.d_res_low 10.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.019 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.034 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes 0.0263 ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol 0.109 ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol 0.155 ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 0.131 ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt 0.006 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt 0.036 ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps 0.083 ? ? ? 'X-RAY DIFFRACTION' ? # _pdbx_refine.entry_id 1MC2 _pdbx_refine.R_factor_all_no_cutoff 0.1043 _pdbx_refine.R_factor_obs_no_cutoff ? _pdbx_refine.free_R_factor_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff 0.0949 _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff 62357 _pdbx_refine.number_reflns_obs_no_cutoff ? _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.free_R_error_no_cutoff ? # _struct.entry_id 1MC2 _struct.title 'monomeric LYS-49 phospholipase A2 homologue purified from AG' _struct.pdbx_descriptor 'phospholipase a2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1MC2 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'YS49-PHOSPHOLIPASE A2, SNAKE VENOM, AGKISTRODON ACUTUS, Toxin' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 1 ? GLY A 14 ? SER A 1001 GLY A 1014 1 ? 14 HELX_P HELX_P2 2 ASN A 16 ? GLY A 22 ? ASN A 1016 GLY A 1023 1 ? 7 HELX_P HELX_P3 3 ASP A 38 ? LYS A 52 ? ASP A 1039 LYS A 1053 1 ? 15 HELX_P HELX_P4 4 GLN A 79 ? ASN A 99 ? GLN A 1089 ASN A 1109 1 ? 21 HELX_P HELX_P5 5 LEU A 100 ? TYR A 103 ? LEU A 1110 TYR A 1113 5 ? 4 HELX_P HELX_P6 6 ASN A 104 ? ARG A 108 ? ASN A 1114 ARG A 1118 5 ? 5 HELX_P HELX_P7 7 LEU A 111 ? CYS A 115 ? LEU A 1121 CYS A 1125 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 115 SG ? ? A CYS 1027 A CYS 1125 1_555 ? ? ? ? ? ? ? 2.056 ? disulf2 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 1029 A CYS 1045 1_555 ? ? ? ? ? ? ? 2.032 ? disulf3 disulf ? ? A CYS 43 SG ? ? ? 1_555 A CYS 95 SG ? ? A CYS 1044 A CYS 1105 1_555 ? ? ? ? ? ? ? 2.044 ? disulf4 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 122 SG ? ? A CYS 1050 A CYS 1134 1_555 ? ? ? ? ? ? ? 2.072 ? disulf5 disulf ? ? A CYS 50 SG ? ? ? 1_555 A CYS 88 SG ? ? A CYS 1051 A CYS 1098 1_555 ? ? ? ? ? ? ? 2.047 ? disulf6 disulf ? ? A CYS 57 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 1061 A CYS 1091 1_555 ? ? ? ? ? ? ? 2.045 ? disulf7 disulf ? ? A CYS 75 SG ? ? ? 1_555 A CYS 86 SG ? ? A CYS 1084 A CYS 1096 1_555 ? ? ? ? ? ? ? 2.038 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 66 ? LYS A 69 ? TYR A 1075 LYS A 1078 A 2 ALA A 72 ? CYS A 75 ? ALA A 1081 CYS A 1084 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 67 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 1076 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 74 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 1083 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE IPA A 1135' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE IPA A 1136' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 PRO A 17 ? PRO A 1017 . ? 1_555 ? 2 AC1 4 HOH D . ? HOH A 2032 . ? 1_555 ? 3 AC1 4 HOH D . ? HOH A 2104 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 2204 . ? 1_555 ? 5 AC2 4 GLY A 6 ? GLY A 1006 . ? 1_555 ? 6 AC2 4 VAL A 18 ? VAL A 1018 . ? 1_555 ? 7 AC2 4 TYR A 109 ? TYR A 1119 . ? 2_555 ? 8 AC2 4 HOH D . ? HOH A 2075 . ? 1_555 ? # _database_PDB_matrix.entry_id 1MC2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 1MC2 _atom_sites.fract_transf_matrix[1][1] 0.022355 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.011603 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016924 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024867 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1001 1001 SER SER A . n A 1 2 LEU 2 1002 1002 LEU LEU A . n A 1 3 PHE 3 1003 1003 PHE PHE A . n A 1 4 GLU 4 1004 1004 GLU GLU A . n A 1 5 LEU 5 1005 1005 LEU LEU A . n A 1 6 GLY 6 1006 1006 GLY GLY A . n A 1 7 LYS 7 1007 1007 LYS LYS A . n A 1 8 MET 8 1008 1008 MET MET A . n A 1 9 ILE 9 1009 1009 ILE ILE A . n A 1 10 TRP 10 1010 1010 TRP TRP A . n A 1 11 GLN 11 1011 1011 GLN GLN A . n A 1 12 GLU 12 1012 1012 GLU GLU A . n A 1 13 THR 13 1013 1013 THR THR A . n A 1 14 GLY 14 1014 1014 GLY GLY A . n A 1 15 LYS 15 1015 1015 LYS LYS A . n A 1 16 ASN 16 1016 1016 ASN ASN A . n A 1 17 PRO 17 1017 1017 PRO PRO A . n A 1 18 VAL 18 1018 1018 VAL VAL A . n A 1 19 LYS 19 1019 1019 LYS LYS A . n A 1 20 ASN 20 1020 1020 ASN ASN A . n A 1 21 TYR 21 1022 1022 TYR TYR A . n A 1 22 GLY 22 1023 1023 GLY GLY A . n A 1 23 LEU 23 1024 1024 LEU LEU A . n A 1 24 TYR 24 1025 1025 TYR TYR A . n A 1 25 GLY 25 1026 1026 GLY GLY A . n A 1 26 CYS 26 1027 1027 CYS CYS A . n A 1 27 ASN 27 1028 1028 ASN ASN A . n A 1 28 CYS 28 1029 1029 CYS CYS A . n A 1 29 GLY 29 1030 1030 GLY GLY A . n A 1 30 VAL 30 1031 1031 VAL VAL A . n A 1 31 GLY 31 1032 1032 GLY GLY A . n A 1 32 GLY 32 1033 1033 GLY GLY A . n A 1 33 ARG 33 1034 1034 ARG ARG A . n A 1 34 GLY 34 1035 1035 GLY GLY A . n A 1 35 GLU 35 1036 1036 GLU GLU A . n A 1 36 PRO 36 1037 1037 PRO PRO A . n A 1 37 LEU 37 1038 1038 LEU LEU A . n A 1 38 ASP 38 1039 1039 ASP ASP A . n A 1 39 ALA 39 1040 1040 ALA ALA A . n A 1 40 THR 40 1041 1041 THR THR A . n A 1 41 ASP 41 1042 1042 ASP ASP A . n A 1 42 ARG 42 1043 1043 ARG ARG A . n A 1 43 CYS 43 1044 1044 CYS CYS A . n A 1 44 CYS 44 1045 1045 CYS CYS A . n A 1 45 PHE 45 1046 1046 PHE PHE A . n A 1 46 VAL 46 1047 1047 VAL VAL A . n A 1 47 HIS 47 1048 1048 HIS HIS A . n A 1 48 LYS 48 1049 1049 LYS LYS A . n A 1 49 CYS 49 1050 1050 CYS CYS A . n A 1 50 CYS 50 1051 1051 CYS CYS A . n A 1 51 TYR 51 1052 1052 TYR TYR A . n A 1 52 LYS 52 1053 1053 LYS LYS A . n A 1 53 LYS 53 1057 1057 LYS LYS A . n A 1 54 LEU 54 1058 1058 LEU LEU A . n A 1 55 THR 55 1059 1059 THR THR A . n A 1 56 ASP 56 1060 1060 ASP ASP A . n A 1 57 CYS 57 1061 1061 CYS CYS A . n A 1 58 ASP 58 1067 1067 ASP ASP A . n A 1 59 SER 59 1068 1068 SER SER A . n A 1 60 LYS 60 1069 1069 LYS LYS A . n A 1 61 LYS 61 1070 1070 LYS LYS A . n A 1 62 ASP 62 1071 1071 ASP ASP A . n A 1 63 ARG 63 1072 1072 ARG ARG A . n A 1 64 TYR 64 1073 1073 TYR TYR A . n A 1 65 SER 65 1074 1074 SER SER A . n A 1 66 TYR 66 1075 1075 TYR TYR A . n A 1 67 LYS 67 1076 1076 LYS LYS A . n A 1 68 TRP 68 1077 1077 TRP TRP A . n A 1 69 LYS 69 1078 1078 LYS LYS A . n A 1 70 ASN 70 1079 1079 ASN ASN A . n A 1 71 LYS 71 1080 1080 LYS LYS A . n A 1 72 ALA 72 1081 1081 ALA ALA A . n A 1 73 ILE 73 1082 1082 ILE ILE A . n A 1 74 VAL 74 1083 1083 VAL VAL A . n A 1 75 CYS 75 1084 1084 CYS CYS A . n A 1 76 GLY 76 1086 1086 GLY GLY A . n A 1 77 LYS 77 1087 1087 LYS LYS A . n A 1 78 ASN 78 1088 1088 ASN ASN A . n A 1 79 GLN 79 1089 1089 GLN GLN A . n A 1 80 PRO 80 1090 1090 PRO PRO A . n A 1 81 CYS 81 1091 1091 CYS CYS A . n A 1 82 MET 82 1092 1092 MET MET A . n A 1 83 GLN 83 1093 1093 GLN GLN A . n A 1 84 GLU 84 1094 1094 GLU GLU A . n A 1 85 MET 85 1095 1095 MET MET A . n A 1 86 CYS 86 1096 1096 CYS CYS A . n A 1 87 GLU 87 1097 1097 GLU GLU A . n A 1 88 CYS 88 1098 1098 CYS CYS A . n A 1 89 ASP 89 1099 1099 ASP ASP A . n A 1 90 LYS 90 1100 1100 LYS LYS A . n A 1 91 ALA 91 1101 1101 ALA ALA A . n A 1 92 PHE 92 1102 1102 PHE PHE A . n A 1 93 ALA 93 1103 1103 ALA ALA A . n A 1 94 ILE 94 1104 1104 ILE ILE A . n A 1 95 CYS 95 1105 1105 CYS CYS A . n A 1 96 LEU 96 1106 1106 LEU LEU A . n A 1 97 ARG 97 1107 1107 ARG ARG A . n A 1 98 GLU 98 1108 1108 GLU GLU A . n A 1 99 ASN 99 1109 1109 ASN ASN A . n A 1 100 LEU 100 1110 1110 LEU LEU A . n A 1 101 ASP 101 1111 1111 ASP ASP A . n A 1 102 THR 102 1112 1112 THR THR A . n A 1 103 TYR 103 1113 1113 TYR TYR A . n A 1 104 ASN 104 1114 1114 ASN ASN A . n A 1 105 LYS 105 1115 1115 LYS LYS A . n A 1 106 SER 106 1116 1116 SER SER A . n A 1 107 PHE 107 1117 1117 PHE PHE A . n A 1 108 ARG 108 1118 1118 ARG ARG A . n A 1 109 TYR 109 1119 1119 TYR TYR A . n A 1 110 HIS 110 1120 1120 HIS HIS A . n A 1 111 LEU 111 1121 1121 LEU LEU A . n A 1 112 LYS 112 1122 1122 LYS LYS A . n A 1 113 PRO 113 1123 1123 PRO PRO A . n A 1 114 SER 114 1124 1124 SER SER A . n A 1 115 CYS 115 1125 1125 CYS CYS A . n A 1 116 LYS 116 1128 1128 LYS LYS A . n A 1 117 LYS 117 1129 1129 LYS LYS A . n A 1 118 THR 118 1130 1130 THR THR A . n A 1 119 SER 119 1131 1131 SER SER A . n A 1 120 GLU 120 1132 1132 GLU GLU A . n A 1 121 GLN 121 1133 1133 GLN GLN A . n A 1 122 CYS 122 1134 1134 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IPA 1 1135 1135 IPA IPA A . C 2 IPA 1 1136 1136 IPA IPA A . D 3 HOH 1 2001 2001 HOH HOH A . D 3 HOH 2 2002 2002 HOH HOH A . D 3 HOH 3 2003 2003 HOH HOH A . D 3 HOH 4 2004 2004 HOH HOH A . D 3 HOH 5 2005 2005 HOH HOH A . D 3 HOH 6 2006 2006 HOH HOH A . D 3 HOH 7 2007 2007 HOH HOH A . D 3 HOH 8 2008 2008 HOH HOH A . D 3 HOH 9 2009 2009 HOH HOH A . D 3 HOH 10 2010 2010 HOH HOH A . D 3 HOH 11 2011 2011 HOH HOH A . D 3 HOH 12 2012 2012 HOH HOH A . D 3 HOH 13 2013 2013 HOH HOH A . D 3 HOH 14 2014 2014 HOH HOH A . D 3 HOH 15 2015 2015 HOH HOH A . D 3 HOH 16 2016 2016 HOH HOH A . D 3 HOH 17 2017 2017 HOH HOH A . D 3 HOH 18 2018 2018 HOH HOH A . D 3 HOH 19 2019 2019 HOH HOH A . D 3 HOH 20 2020 2020 HOH HOH A . D 3 HOH 21 2021 2021 HOH HOH A . D 3 HOH 22 2022 2022 HOH HOH A . D 3 HOH 23 2023 2023 HOH HOH A . D 3 HOH 24 2024 2024 HOH HOH A . D 3 HOH 25 2025 2025 HOH HOH A . D 3 HOH 26 2026 2026 HOH HOH A . D 3 HOH 27 2027 2027 HOH HOH A . D 3 HOH 28 2028 2028 HOH HOH A . D 3 HOH 29 2029 2029 HOH HOH A . D 3 HOH 30 2030 2030 HOH HOH A . D 3 HOH 31 2031 2031 HOH HOH A . D 3 HOH 32 2032 2032 HOH HOH A . D 3 HOH 33 2033 2033 HOH HOH A . D 3 HOH 34 2034 2034 HOH HOH A . D 3 HOH 35 2035 2035 HOH HOH A . D 3 HOH 36 2036 2036 HOH HOH A . D 3 HOH 37 2037 2037 HOH HOH A . D 3 HOH 38 2038 2038 HOH HOH A . D 3 HOH 39 2039 2039 HOH HOH A . D 3 HOH 40 2040 2040 HOH HOH A . D 3 HOH 41 2041 2041 HOH HOH A . D 3 HOH 42 2042 2042 HOH HOH A . D 3 HOH 43 2043 2043 HOH HOH A . D 3 HOH 44 2044 2044 HOH HOH A . D 3 HOH 45 2045 2045 HOH HOH A . D 3 HOH 46 2046 2046 HOH HOH A . D 3 HOH 47 2047 2047 HOH HOH A . D 3 HOH 48 2048 2048 HOH HOH A . D 3 HOH 49 2049 2049 HOH HOH A . D 3 HOH 50 2050 2050 HOH HOH A . D 3 HOH 51 2051 2051 HOH HOH A . D 3 HOH 52 2052 2052 HOH HOH A . D 3 HOH 53 2053 2053 HOH HOH A . D 3 HOH 54 2054 2054 HOH HOH A . D 3 HOH 55 2055 2055 HOH HOH A . D 3 HOH 56 2056 2056 HOH HOH A . D 3 HOH 57 2057 2057 HOH HOH A . D 3 HOH 58 2058 2058 HOH HOH A . D 3 HOH 59 2059 2059 HOH HOH A . D 3 HOH 60 2060 2060 HOH HOH A . D 3 HOH 61 2061 2061 HOH HOH A . D 3 HOH 62 2062 2062 HOH HOH A . D 3 HOH 63 2063 2063 HOH HOH A . D 3 HOH 64 2064 2064 HOH HOH A . D 3 HOH 65 2065 2065 HOH HOH A . D 3 HOH 66 2066 2066 HOH HOH A . D 3 HOH 67 2067 2067 HOH HOH A . D 3 HOH 68 2068 2068 HOH HOH A . D 3 HOH 69 2069 2069 HOH HOH A . D 3 HOH 70 2070 2070 HOH HOH A . D 3 HOH 71 2071 2071 HOH HOH A . D 3 HOH 72 2072 2072 HOH HOH A . D 3 HOH 73 2073 2073 HOH HOH A . D 3 HOH 74 2074 2074 HOH HOH A . D 3 HOH 75 2075 2075 HOH HOH A . D 3 HOH 76 2076 2076 HOH HOH A . D 3 HOH 77 2077 2077 HOH HOH A . D 3 HOH 78 2078 2078 HOH HOH A . D 3 HOH 79 2079 2079 HOH HOH A . D 3 HOH 80 2080 2080 HOH HOH A . D 3 HOH 81 2081 2081 HOH HOH A . D 3 HOH 82 2082 2082 HOH HOH A . D 3 HOH 83 2083 2083 HOH HOH A . D 3 HOH 84 2084 2084 HOH HOH A . D 3 HOH 85 2085 2085 HOH HOH A . D 3 HOH 86 2086 2086 HOH HOH A . D 3 HOH 87 2087 2087 HOH HOH A . D 3 HOH 88 2088 2088 HOH HOH A . D 3 HOH 89 2089 2089 HOH HOH A . D 3 HOH 90 2090 2090 HOH HOH A . D 3 HOH 91 2091 2091 HOH HOH A . D 3 HOH 92 2092 2092 HOH HOH A . D 3 HOH 93 2093 2093 HOH HOH A . D 3 HOH 94 2094 2094 HOH HOH A . D 3 HOH 95 2095 2095 HOH HOH A . D 3 HOH 96 2096 2096 HOH HOH A . D 3 HOH 97 2097 2097 HOH HOH A . D 3 HOH 98 2098 2098 HOH HOH A . D 3 HOH 99 2099 2099 HOH HOH A . D 3 HOH 100 2100 2100 HOH HOH A . D 3 HOH 101 2101 2101 HOH HOH A . D 3 HOH 102 2102 2102 HOH HOH A . D 3 HOH 103 2103 2103 HOH HOH A . D 3 HOH 104 2104 2104 HOH HOH A . D 3 HOH 105 2105 2105 HOH HOH A . D 3 HOH 106 2106 2106 HOH HOH A . D 3 HOH 107 2107 2107 HOH HOH A . D 3 HOH 108 2108 2108 HOH HOH A . D 3 HOH 109 2109 2109 HOH HOH A . D 3 HOH 110 2110 2110 HOH HOH A . D 3 HOH 111 2111 2111 HOH HOH A . D 3 HOH 112 2112 2112 HOH HOH A . D 3 HOH 113 2113 2113 HOH HOH A . D 3 HOH 114 2114 2114 HOH HOH A . D 3 HOH 115 2115 2115 HOH HOH A . D 3 HOH 116 2116 2116 HOH HOH A . D 3 HOH 117 2117 2117 HOH HOH A . D 3 HOH 118 2118 2118 HOH HOH A . D 3 HOH 119 2119 2119 HOH HOH A . D 3 HOH 120 2120 2120 HOH HOH A . D 3 HOH 121 2121 2121 HOH HOH A . D 3 HOH 122 2122 2122 HOH HOH A . D 3 HOH 123 2123 2123 HOH HOH A . D 3 HOH 124 2124 2124 HOH HOH A . D 3 HOH 125 2125 2125 HOH HOH A . D 3 HOH 126 2126 2126 HOH HOH A . D 3 HOH 127 2127 2127 HOH HOH A . D 3 HOH 128 2128 2128 HOH HOH A . D 3 HOH 129 2129 2129 HOH HOH A . D 3 HOH 130 2130 2130 HOH HOH A . D 3 HOH 131 2131 2131 HOH HOH A . D 3 HOH 132 2132 2132 HOH HOH A . D 3 HOH 133 2133 2133 HOH HOH A . D 3 HOH 134 2134 2134 HOH HOH A . D 3 HOH 135 2135 2135 HOH HOH A . D 3 HOH 136 2136 2136 HOH HOH A . D 3 HOH 137 2137 2137 HOH HOH A . D 3 HOH 138 2138 2138 HOH HOH A . D 3 HOH 139 2139 2139 HOH HOH A . D 3 HOH 140 2140 2140 HOH HOH A . D 3 HOH 141 2141 2141 HOH HOH A . D 3 HOH 142 2142 2142 HOH HOH A . D 3 HOH 143 2143 2143 HOH HOH A . D 3 HOH 144 2144 2144 HOH HOH A . D 3 HOH 145 2145 2145 HOH HOH A . D 3 HOH 146 2146 2146 HOH HOH A . D 3 HOH 147 2147 2147 HOH HOH A . D 3 HOH 148 2148 2148 HOH HOH A . D 3 HOH 149 2149 2149 HOH HOH A . D 3 HOH 150 2150 2150 HOH HOH A . D 3 HOH 151 2151 2151 HOH HOH A . D 3 HOH 152 2152 2152 HOH HOH A . D 3 HOH 153 2153 2153 HOH HOH A . D 3 HOH 154 2154 2154 HOH HOH A . D 3 HOH 155 2155 2155 HOH HOH A . D 3 HOH 156 2156 2156 HOH HOH A . D 3 HOH 157 2157 2157 HOH HOH A . D 3 HOH 158 2158 2158 HOH HOH A . D 3 HOH 159 2159 2159 HOH HOH A . D 3 HOH 160 2160 2160 HOH HOH A . D 3 HOH 161 2161 2161 HOH HOH A . D 3 HOH 162 2162 2162 HOH HOH A . D 3 HOH 163 2163 2163 HOH HOH A . D 3 HOH 164 2164 2164 HOH HOH A . D 3 HOH 165 2165 2165 HOH HOH A . D 3 HOH 166 2166 2166 HOH HOH A . D 3 HOH 167 2167 2167 HOH HOH A . D 3 HOH 168 2168 2168 HOH HOH A . D 3 HOH 169 2169 2169 HOH HOH A . D 3 HOH 170 2170 2170 HOH HOH A . D 3 HOH 171 2171 2171 HOH HOH A . D 3 HOH 172 2172 2172 HOH HOH A . D 3 HOH 173 2173 2173 HOH HOH A . D 3 HOH 174 2174 2174 HOH HOH A . D 3 HOH 175 2175 2175 HOH HOH A . D 3 HOH 176 2176 2176 HOH HOH A . D 3 HOH 177 2177 2177 HOH HOH A . D 3 HOH 178 2178 2178 HOH HOH A . D 3 HOH 179 2179 2179 HOH HOH A . D 3 HOH 180 2180 2180 HOH HOH A . D 3 HOH 181 2181 2181 HOH HOH A . D 3 HOH 182 2182 2182 HOH HOH A . D 3 HOH 183 2183 2183 HOH HOH A . D 3 HOH 184 2184 2184 HOH HOH A . D 3 HOH 185 2185 2185 HOH HOH A . D 3 HOH 186 2186 2186 HOH HOH A . D 3 HOH 187 2187 2187 HOH HOH A . D 3 HOH 188 2188 2188 HOH HOH A . D 3 HOH 189 2189 2189 HOH HOH A . D 3 HOH 190 2190 2190 HOH HOH A . D 3 HOH 191 2191 2191 HOH HOH A . D 3 HOH 192 2192 2192 HOH HOH A . D 3 HOH 193 2193 2193 HOH HOH A . D 3 HOH 194 2194 2194 HOH HOH A . D 3 HOH 195 2195 2195 HOH HOH A . D 3 HOH 196 2196 2196 HOH HOH A . D 3 HOH 197 2197 2197 HOH HOH A . D 3 HOH 198 2198 2198 HOH HOH A . D 3 HOH 199 2199 2199 HOH HOH A . D 3 HOH 200 2200 2200 HOH HOH A . D 3 HOH 201 2201 2201 HOH HOH A . D 3 HOH 202 2202 2202 HOH HOH A . D 3 HOH 203 2203 2203 HOH HOH A . D 3 HOH 204 2204 2204 HOH HOH A . D 3 HOH 205 2205 2205 HOH HOH A . D 3 HOH 206 2206 2206 HOH HOH A . D 3 HOH 207 2207 2207 HOH HOH A . D 3 HOH 208 2208 2208 HOH HOH A . D 3 HOH 209 2209 2209 HOH HOH A . D 3 HOH 210 2210 2210 HOH HOH A . D 3 HOH 211 2211 2211 HOH HOH A . D 3 HOH 212 2212 2212 HOH HOH A . D 3 HOH 213 2213 2213 HOH HOH A . D 3 HOH 214 2214 2214 HOH HOH A . D 3 HOH 215 2215 2215 HOH HOH A . D 3 HOH 216 2216 2216 HOH HOH A . D 3 HOH 217 2217 2217 HOH HOH A . D 3 HOH 218 2218 2218 HOH HOH A . D 3 HOH 219 2219 2219 HOH HOH A . D 3 HOH 220 2220 2220 HOH HOH A . D 3 HOH 221 2221 2221 HOH HOH A . D 3 HOH 222 2222 2222 HOH HOH A . D 3 HOH 223 2223 2223 HOH HOH A . D 3 HOH 224 2224 2224 HOH HOH A . D 3 HOH 225 2225 2225 HOH HOH A . D 3 HOH 226 2226 2226 HOH HOH A . D 3 HOH 227 2227 2227 HOH HOH A . D 3 HOH 228 2228 2228 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2004 ? D HOH . 2 1 A HOH 2044 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-08-21 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 5 'Structure model' 1 4 2018-02-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Experimental preparation' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' exptl_crystal_grow # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_exptl_crystal_grow.pdbx_details' 2 5 'Structure model' '_exptl_crystal_grow.temp' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language DENZO 'data reduction' . ? 1 ? ? ? ? SCALEPACK 'data scaling' . ? 2 ? ? ? ? SnB phasing . ? 3 ? ? ? ? SHELXL-97 refinement . ? 4 ? ? ? ? # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 1134 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 O _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 CYS _pdbx_validate_rmsd_bond.auth_seq_id_2 1134 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 0.996 _pdbx_validate_rmsd_bond.bond_target_value 1.229 _pdbx_validate_rmsd_bond.bond_deviation -0.233 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG1 A VAL 1018 ? B CB A VAL 1018 ? B CG2 A VAL 1018 ? B 99.12 110.90 -11.78 1.60 N 2 1 NE A ARG 1034 ? ? CZ A ARG 1034 ? ? NH1 A ARG 1034 ? ? 123.48 120.30 3.18 0.50 N 3 1 CD A ARG 1043 ? B NE A ARG 1043 ? B CZ A ARG 1043 ? B 170.62 123.60 47.02 1.40 N 4 1 NH1 A ARG 1043 ? A CZ A ARG 1043 ? A NH2 A ARG 1043 ? A 127.43 119.40 8.03 1.10 N 5 1 NH1 A ARG 1043 ? B CZ A ARG 1043 ? B NH2 A ARG 1043 ? B 110.15 119.40 -9.25 1.10 N 6 1 NE A ARG 1043 ? B CZ A ARG 1043 ? B NH1 A ARG 1043 ? B 114.01 120.30 -6.29 0.50 N 7 1 NE A ARG 1043 ? A CZ A ARG 1043 ? A NH2 A ARG 1043 ? A 114.28 120.30 -6.02 0.50 N 8 1 NE A ARG 1043 ? B CZ A ARG 1043 ? B NH2 A ARG 1043 ? B 135.83 120.30 15.53 0.50 N 9 1 NE A ARG 1107 ? A CZ A ARG 1107 ? A NH1 A ARG 1107 ? A 124.55 120.30 4.25 0.50 N 10 1 CA A LYS 1122 ? ? CB A LYS 1122 ? ? CG A LYS 1122 ? ? 98.83 113.40 -14.57 2.20 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 1024 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -144.97 _pdbx_validate_torsion.psi 20.06 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ISOPROPYL ALCOHOL' IPA 3 water HOH #