data_1N9J # _entry.id 1N9J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1N9J pdb_00001n9j 10.2210/pdb1n9j/pdb RCSB RCSB017687 ? ? WWPDB D_1000017687 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1DVC _pdbx_database_related.details 'Solution NMR Structure Of Monomeric Human Stefin A at pH 5.5 and 308K' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1N9J _pdbx_database_status.recvd_initial_deposition_date 2002-11-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Staniforth, R.A.' 1 'Giannini, S.' 2 'Higgins, L.D.' 3 'Conroy, M.J.' 4 'Hounslow, A.M.' 5 'Jerala, R.' 6 'Craven, C.J.' 7 'Waltho, J.P.' 8 # _citation.id primary _citation.title 'Three-dimensional domain swapping in the folded and molten-globule states of cystatins, an amyloid-forming structural superfamily' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 20 _citation.page_first 4774 _citation.page_last 4781 _citation.year 2001 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11532941 _citation.pdbx_database_id_DOI 10.1093/emboj/20.17.4774 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Staniforth, R.A.' 1 ? primary 'Giannini, S.' 2 ? primary 'Higgins, L.D.' 3 ? primary 'Conroy, M.J.' 4 ? primary 'Hounslow, A.M.' 5 ? primary 'Jerala, R.' 6 ? primary 'Craven, C.J.' 7 ? primary 'Waltho, J.P.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cystatin A' _entity.formula_weight 11020.464 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Stefin A, Cystatin AS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDL VLTGYQVDKNKDDELTGF ; _entity_poly.pdbx_seq_one_letter_code_can ;MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDL VLTGYQVDKNKDDELTGF ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 PRO n 1 4 GLY n 1 5 GLY n 1 6 LEU n 1 7 SER n 1 8 GLU n 1 9 ALA n 1 10 LYS n 1 11 PRO n 1 12 ALA n 1 13 THR n 1 14 PRO n 1 15 GLU n 1 16 ILE n 1 17 GLN n 1 18 GLU n 1 19 ILE n 1 20 VAL n 1 21 ASP n 1 22 LYS n 1 23 VAL n 1 24 LYS n 1 25 PRO n 1 26 GLN n 1 27 LEU n 1 28 GLU n 1 29 GLU n 1 30 LYS n 1 31 THR n 1 32 ASN n 1 33 GLU n 1 34 THR n 1 35 TYR n 1 36 GLY n 1 37 LYS n 1 38 LEU n 1 39 GLU n 1 40 ALA n 1 41 VAL n 1 42 GLN n 1 43 TYR n 1 44 LYS n 1 45 THR n 1 46 GLN n 1 47 VAL n 1 48 VAL n 1 49 ALA n 1 50 GLY n 1 51 THR n 1 52 ASN n 1 53 TYR n 1 54 TYR n 1 55 ILE n 1 56 LYS n 1 57 VAL n 1 58 ARG n 1 59 ALA n 1 60 GLY n 1 61 ASP n 1 62 ASN n 1 63 LYS n 1 64 TYR n 1 65 MET n 1 66 HIS n 1 67 LEU n 1 68 LYS n 1 69 VAL n 1 70 PHE n 1 71 LYS n 1 72 SER n 1 73 LEU n 1 74 PRO n 1 75 GLY n 1 76 GLN n 1 77 ASN n 1 78 GLU n 1 79 ASP n 1 80 LEU n 1 81 VAL n 1 82 LEU n 1 83 THR n 1 84 GLY n 1 85 TYR n 1 86 GLN n 1 87 VAL n 1 88 ASP n 1 89 LYS n 1 90 ASN n 1 91 LYS n 1 92 ASP n 1 93 ASP n 1 94 GLU n 1 95 LEU n 1 96 THR n 1 97 GLY n 1 98 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21-DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET3A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYTA_HUMAN _struct_ref.pdbx_db_accession P01040 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDL VLTGYQVDKNKDDELTGF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1N9J A 1 ? 98 ? P01040 1 ? 98 ? 1 98 2 1 1N9J B 1 ? 98 ? P01040 1 ? 98 ? 1 98 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 HNCA 2 1 1 HNCO 3 1 1 'HN(CA)CB' 4 1 1 TOCSY-HSQC 5 1 1 NOESY-HSQC 6 2 1 '15N-isotope-filtered NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.2mM Stefin A U-15N; 50mM phosphate buffer pH 5.5, 100mM KCl, 5mM Azide; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1mM Stefin A U-15N,13C,2H; 50mM phosphate buffer pH 5.5, 100mM KCl, 5mM Azide; 90% H2O, 10% D2O' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker DRX 800 # _pdbx_nmr_refine.entry_id 1N9J _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Distance restraints (NOEs and hydrogen bonds) were taken from the data used for the stefin A monomer structure (Martin et al., 1995), except those involving residues V48-G50 and N77-L80 where chemical shift perturbation was observed following resonance assignment. The NOEs were specified as intermolecular and intramolecular according to domain-swapped topology inferred from isotope filtering experiments. An additional hydrogen bond restraint was included between 48 and 50 based on evidence from protection experiments on the dimer (Jerala and Zerovnik, 1999). Dihedral restraints (phi and psi) were determined using the 1H-alpha, 15N, 13C-alpha, 13C-beta and 13C' chemical shifts and the program TALOS (Cornilescu et al., 1999). Where TALOS gave a `poor' match, the experimental phi dihedral angle was taken from the data used for the stefin A monomer structure calculation. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1N9J _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1N9J _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 Felix 2000 'data analysis' MSI 2 X-PLOR 3.1 refinement BRUNGER 3 # _exptl.entry_id 1N9J _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1N9J _struct.title 'Solution Structure of the 3D domain swapped dimer of Stefin A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1N9J _struct_keywords.pdbx_keywords 'HYDROLASE INHIBITOR' _struct_keywords.text 'domain swapped, stefin A, cystatins, amyloid, HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 13 ? ASN A 32 ? THR A 13 ASN A 32 1 ? 20 HELX_P HELX_P2 2 GLN A 76 ? LEU A 80 ? GLN A 76 LEU A 80 5 ? 5 HELX_P HELX_P3 3 THR B 13 ? ASN B 32 ? THR B 13 ASN B 32 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 37 ? ALA A 40 ? LYS A 37 ALA A 40 A 2 VAL B 57 ? GLY B 60 ? VAL B 57 GLY B 60 B 1 VAL A 81 ? GLN A 86 ? VAL A 81 GLN A 86 B 2 MET A 65 ? LYS A 71 ? MET A 65 LYS A 71 B 3 LYS A 44 ? ARG A 58 ? LYS A 44 ARG A 58 B 4 GLU B 39 ? TYR B 54 ? GLU B 39 TYR B 54 B 5 LYS B 68 ? LYS B 71 ? LYS B 68 LYS B 71 B 6 LEU B 80 ? GLY B 84 ? LEU B 80 GLY B 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 39 ? N GLU A 39 O ARG B 58 ? O ARG B 58 B 1 2 O VAL A 81 ? O VAL A 81 N PHE A 70 ? N PHE A 70 B 2 3 O LEU A 67 ? O LEU A 67 N ILE A 55 ? N ILE A 55 B 3 4 N TYR A 54 ? N TYR A 54 O LYS B 44 ? O LYS B 44 B 4 5 N THR B 51 ? N THR B 51 O LYS B 71 ? O LYS B 71 B 5 6 N PHE B 70 ? N PHE B 70 O VAL B 81 ? O VAL B 81 # _database_PDB_matrix.entry_id 1N9J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1N9J _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 PHE 98 98 98 PHE PHE A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 ILE 2 2 2 ILE ILE B . n B 1 3 PRO 3 3 3 PRO PRO B . n B 1 4 GLY 4 4 4 GLY GLY B . n B 1 5 GLY 5 5 5 GLY GLY B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 SER 7 7 7 SER SER B . n B 1 8 GLU 8 8 8 GLU GLU B . n B 1 9 ALA 9 9 9 ALA ALA B . n B 1 10 LYS 10 10 10 LYS LYS B . n B 1 11 PRO 11 11 11 PRO PRO B . n B 1 12 ALA 12 12 12 ALA ALA B . n B 1 13 THR 13 13 13 THR THR B . n B 1 14 PRO 14 14 14 PRO PRO B . n B 1 15 GLU 15 15 15 GLU GLU B . n B 1 16 ILE 16 16 16 ILE ILE B . n B 1 17 GLN 17 17 17 GLN GLN B . n B 1 18 GLU 18 18 18 GLU GLU B . n B 1 19 ILE 19 19 19 ILE ILE B . n B 1 20 VAL 20 20 20 VAL VAL B . n B 1 21 ASP 21 21 21 ASP ASP B . n B 1 22 LYS 22 22 22 LYS LYS B . n B 1 23 VAL 23 23 23 VAL VAL B . n B 1 24 LYS 24 24 24 LYS LYS B . n B 1 25 PRO 25 25 25 PRO PRO B . n B 1 26 GLN 26 26 26 GLN GLN B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 THR 31 31 31 THR THR B . n B 1 32 ASN 32 32 32 ASN ASN B . n B 1 33 GLU 33 33 33 GLU GLU B . n B 1 34 THR 34 34 34 THR THR B . n B 1 35 TYR 35 35 35 TYR TYR B . n B 1 36 GLY 36 36 36 GLY GLY B . n B 1 37 LYS 37 37 37 LYS LYS B . n B 1 38 LEU 38 38 38 LEU LEU B . n B 1 39 GLU 39 39 39 GLU GLU B . n B 1 40 ALA 40 40 40 ALA ALA B . n B 1 41 VAL 41 41 41 VAL VAL B . n B 1 42 GLN 42 42 42 GLN GLN B . n B 1 43 TYR 43 43 43 TYR TYR B . n B 1 44 LYS 44 44 44 LYS LYS B . n B 1 45 THR 45 45 45 THR THR B . n B 1 46 GLN 46 46 46 GLN GLN B . n B 1 47 VAL 47 47 47 VAL VAL B . n B 1 48 VAL 48 48 48 VAL VAL B . n B 1 49 ALA 49 49 49 ALA ALA B . n B 1 50 GLY 50 50 50 GLY GLY B . n B 1 51 THR 51 51 51 THR THR B . n B 1 52 ASN 52 52 52 ASN ASN B . n B 1 53 TYR 53 53 53 TYR TYR B . n B 1 54 TYR 54 54 54 TYR TYR B . n B 1 55 ILE 55 55 55 ILE ILE B . n B 1 56 LYS 56 56 56 LYS LYS B . n B 1 57 VAL 57 57 57 VAL VAL B . n B 1 58 ARG 58 58 58 ARG ARG B . n B 1 59 ALA 59 59 59 ALA ALA B . n B 1 60 GLY 60 60 60 GLY GLY B . n B 1 61 ASP 61 61 61 ASP ASP B . n B 1 62 ASN 62 62 62 ASN ASN B . n B 1 63 LYS 63 63 63 LYS LYS B . n B 1 64 TYR 64 64 64 TYR TYR B . n B 1 65 MET 65 65 65 MET MET B . n B 1 66 HIS 66 66 66 HIS HIS B . n B 1 67 LEU 67 67 67 LEU LEU B . n B 1 68 LYS 68 68 68 LYS LYS B . n B 1 69 VAL 69 69 69 VAL VAL B . n B 1 70 PHE 70 70 70 PHE PHE B . n B 1 71 LYS 71 71 71 LYS LYS B . n B 1 72 SER 72 72 72 SER SER B . n B 1 73 LEU 73 73 73 LEU LEU B . n B 1 74 PRO 74 74 74 PRO PRO B . n B 1 75 GLY 75 75 75 GLY GLY B . n B 1 76 GLN 76 76 76 GLN GLN B . n B 1 77 ASN 77 77 77 ASN ASN B . n B 1 78 GLU 78 78 78 GLU GLU B . n B 1 79 ASP 79 79 79 ASP ASP B . n B 1 80 LEU 80 80 80 LEU LEU B . n B 1 81 VAL 81 81 81 VAL VAL B . n B 1 82 LEU 82 82 82 LEU LEU B . n B 1 83 THR 83 83 83 THR THR B . n B 1 84 GLY 84 84 84 GLY GLY B . n B 1 85 TYR 85 85 85 TYR TYR B . n B 1 86 GLN 86 86 86 GLN GLN B . n B 1 87 VAL 87 87 87 VAL VAL B . n B 1 88 ASP 88 88 88 ASP ASP B . n B 1 89 LYS 89 89 89 LYS LYS B . n B 1 90 ASN 90 90 90 ASN ASN B . n B 1 91 LYS 91 91 91 LYS LYS B . n B 1 92 ASP 92 92 92 ASP ASP B . n B 1 93 ASP 93 93 93 ASP ASP B . n B 1 94 GLU 94 94 94 GLU GLU B . n B 1 95 LEU 95 95 95 LEU LEU B . n B 1 96 THR 96 96 96 THR THR B . n B 1 97 GLY 97 97 97 GLY GLY B . n B 1 98 PHE 98 98 98 PHE PHE B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-02-25 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 8 ? ? OE2 A GLU 8 ? ? 1.361 1.252 0.109 0.011 N 2 1 CD A GLU 15 ? ? OE2 A GLU 15 ? ? 1.362 1.252 0.110 0.011 N 3 1 CD A GLU 18 ? ? OE2 A GLU 18 ? ? 1.364 1.252 0.112 0.011 N 4 1 CD A GLU 28 ? ? OE2 A GLU 28 ? ? 1.361 1.252 0.109 0.011 N 5 1 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.363 1.252 0.111 0.011 N 6 1 CD A GLU 33 ? ? OE2 A GLU 33 ? ? 1.363 1.252 0.111 0.011 N 7 1 CD A GLU 39 ? ? OE2 A GLU 39 ? ? 1.363 1.252 0.111 0.011 N 8 1 CD A GLU 78 ? ? OE2 A GLU 78 ? ? 1.361 1.252 0.109 0.011 N 9 1 CD A GLU 94 ? ? OE2 A GLU 94 ? ? 1.362 1.252 0.110 0.011 N 10 1 CD B GLU 8 ? ? OE2 B GLU 8 ? ? 1.361 1.252 0.109 0.011 N 11 1 CD B GLU 15 ? ? OE2 B GLU 15 ? ? 1.363 1.252 0.111 0.011 N 12 1 CD B GLU 18 ? ? OE2 B GLU 18 ? ? 1.362 1.252 0.110 0.011 N 13 1 CD B GLU 28 ? ? OE2 B GLU 28 ? ? 1.353 1.252 0.101 0.011 N 14 1 CD B GLU 29 ? ? OE2 B GLU 29 ? ? 1.363 1.252 0.111 0.011 N 15 1 CD B GLU 33 ? ? OE2 B GLU 33 ? ? 1.363 1.252 0.111 0.011 N 16 1 CD B GLU 39 ? ? OE2 B GLU 39 ? ? 1.358 1.252 0.106 0.011 N 17 1 CD B GLU 78 ? ? OE2 B GLU 78 ? ? 1.362 1.252 0.110 0.011 N 18 1 CD B GLU 94 ? ? OE2 B GLU 94 ? ? 1.361 1.252 0.109 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 21 ? ? CG A ASP 21 ? ? OD1 A ASP 21 ? ? 123.83 118.30 5.53 0.90 N 2 1 CB A TYR 35 ? ? CG A TYR 35 ? ? CD2 A TYR 35 ? ? 116.99 121.00 -4.01 0.60 N 3 1 CB A TYR 43 ? ? CG A TYR 43 ? ? CD1 A TYR 43 ? ? 116.98 121.00 -4.02 0.60 N 4 1 CB A ASP 93 ? ? CG A ASP 93 ? ? OD1 A ASP 93 ? ? 124.00 118.30 5.70 0.90 N 5 1 ND1 B HIS 66 ? ? CE1 B HIS 66 ? ? NE2 B HIS 66 ? ? 119.35 111.50 7.85 1.30 N 6 1 CB B ASP 79 ? ? CG B ASP 79 ? ? OD1 B ASP 79 ? ? 124.26 118.30 5.96 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 11 ? ? -66.47 9.19 2 1 ALA A 12 ? ? 148.15 135.72 3 1 VAL A 41 ? ? -131.83 -141.72 4 1 ASP A 61 ? ? -34.07 -29.33 5 1 SER A 72 ? ? -109.56 -80.54 6 1 TYR A 85 ? ? -172.84 126.89 7 1 ASP A 88 ? ? -38.25 4.15 8 1 SER B 7 ? ? -66.81 -174.62 9 1 PRO B 11 ? ? -66.06 6.37 10 1 ALA B 12 ? ? 150.26 74.81 11 1 VAL B 41 ? ? -138.56 -146.65 12 1 VAL B 57 ? ? -162.60 117.29 13 1 SER B 72 ? ? -86.90 -91.61 14 1 ASP B 88 ? ? -24.35 -8.86 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ARG _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 58 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ALA _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 59 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 134.41 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 58 ? ? 0.309 'SIDE CHAIN' 2 1 PHE A 98 ? ? 0.130 'SIDE CHAIN' 3 1 TYR B 53 ? ? 0.080 'SIDE CHAIN' 4 1 TYR B 54 ? ? 0.076 'SIDE CHAIN' 5 1 ARG B 58 ? ? 0.282 'SIDE CHAIN' 6 1 TYR B 85 ? ? 0.067 'SIDE CHAIN' 7 1 PHE B 98 ? ? 0.103 'SIDE CHAIN' #