data_1NJ3 # _entry.id 1NJ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NJ3 pdb_00001nj3 10.2210/pdb1nj3/pdb RCSB RCSB017911 ? ? WWPDB D_1000017911 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-04-22 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-22 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_related 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_nmr_software 8 5 'Structure model' pdbx_struct_conn_angle 9 5 'Structure model' struct_conn 10 5 'Structure model' struct_ref_seq_dif 11 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_related.db_id' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_nmr_software.name' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.value' 10 5 'Structure model' '_struct_conn.pdbx_dist_value' 11 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 12 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 13 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 14 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 15 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 16 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 17 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 18 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 19 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 20 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 21 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 22 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 23 5 'Structure model' '_struct_ref_seq_dif.details' 24 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 25 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 26 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NJ3 _pdbx_database_status.recvd_initial_deposition_date 2002-12-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1FHH 'structurally related to rebredoxin' unspecified PDB 1DVB 'structurally realted to rubrerythrin' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, B.' 1 'Alam, S.L.' 2 'Meyer, H.H.' 3 'Payne, M.' 4 'Stemmler, T.L.' 5 'Davis, D.R.' 6 'Sundquist, W.I.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure and ubiquitin interactions of the conserved zinc finger domain of Npl4.' J.Biol.Chem. 278 20225 20234 2003 JBCHA3 US 0021-9258 0071 ? 12644454 10.1074/jbc.M300459200 1 'A complex of mammalian ufd1 and nlp4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport' 'Embo J.' 15 2181 2192 2000 EMJODG UK 0261-4189 0897 ? ? 10.1093/emboj/19.10.2181 2 'Direct binding of ubiquitin conjugates by the mammalian p97 adapter complexes, p47 and ufd1-Npl4' 'Embo J.' 21 5645 5652 2002 EMJODG UK 0261-4189 0897 ? ? 10.1093/emboj/cdf579 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, B.' 1 ? primary 'Alam, S.L.' 2 ? primary 'Meyer, H.H.' 3 ? primary 'Payne, M.' 4 ? primary 'Stemmler, T.L.' 5 ? primary 'Davis, D.R.' 6 ? primary 'Sundquist, W.I.' 7 ? 1 'Meyer, H.H.' 8 ? 1 'Shorter, J.G.' 9 ? 1 'Pappin, D.' 10 ? 1 'Warren, G.' 11 ? 2 'Meyer, H.H.' 12 ? 2 'Wang, Y.' 13 ? 2 'Warren, G.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man NPL4 3376.865 1 ? ? 'NZF domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSTSAMWACQHCTFMNQPGTGHCEMCSLPRT _entity_poly.pdbx_seq_one_letter_code_can GSTSAMWACQHCTFMNQPGTGHCEMCSLPRT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 THR n 1 4 SER n 1 5 ALA n 1 6 MET n 1 7 TRP n 1 8 ALA n 1 9 CYS n 1 10 GLN n 1 11 HIS n 1 12 CYS n 1 13 THR n 1 14 PHE n 1 15 MET n 1 16 ASN n 1 17 GLN n 1 18 PRO n 1 19 GLY n 1 20 THR n 1 21 GLY n 1 22 HIS n 1 23 CYS n 1 24 GLU n 1 25 MET n 1 26 CYS n 1 27 SER n 1 28 LEU n 1 29 PRO n 1 30 ARG n 1 31 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene Npl4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-4T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 THR 31 31 31 THR THR A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 32 _pdbx_nonpoly_scheme.auth_seq_num 32 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 1NJ3 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NJ3 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1NJ3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1NJ3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1NJ3 _struct.title 'Structure and Ubiquitin Interactions of the Conserved NZF Domain of Npl4' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NJ3 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'NZF domain, Npl4, rubredoxin knuckle, beta-ribbon, zinc-finger, ubiquitin, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NPL4_RAT _struct_ref.pdbx_db_accession Q9ES54 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TSAMWACQHCTFMNQPGTGHCEMCSLPRT _struct_ref.pdbx_align_begin 580 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NJ3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9ES54 _struct_ref_seq.db_align_beg 580 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 608 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 31 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1NJ3 GLY A 1 ? UNP Q9ES54 ? ? 'cloning artifact' 1 1 1 1NJ3 SER A 2 ? UNP Q9ES54 ? ? 'cloning artifact' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 9 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 9 A ZN 32 1_555 ? ? ? ? ? ? ? 2.423 ? ? metalc2 metalc ? ? A CYS 12 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 12 A ZN 32 1_555 ? ? ? ? ? ? ? 2.312 ? ? metalc3 metalc ? ? A CYS 23 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 23 A ZN 32 1_555 ? ? ? ? ? ? ? 2.412 ? ? metalc4 metalc ? ? A CYS 26 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 26 A ZN 32 1_555 ? ? ? ? ? ? ? 2.295 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 12 ? A CYS 12 ? 1_555 104.4 ? 2 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 23 ? A CYS 23 ? 1_555 101.2 ? 3 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 23 ? A CYS 23 ? 1_555 105.8 ? 4 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 106.0 ? 5 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 130.3 ? 6 SG ? A CYS 23 ? A CYS 23 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 105.7 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 7 ? ALA A 8 ? TRP A 7 ALA A 8 A 2 MET A 15 ? ASN A 16 ? MET A 15 ASN A 16 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TRP _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 7 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TRP _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 7 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ASN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 16 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 16 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 32 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 32' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 9 ? CYS A 9 . ? 1_555 ? 2 AC1 4 CYS A 12 ? CYS A 12 . ? 1_555 ? 3 AC1 4 CYS A 23 ? CYS A 23 . ? 1_555 ? 4 AC1 4 CYS A 26 ? CYS A 26 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 60.43 84.61 2 1 THR A 3 ? ? -129.26 -168.37 3 1 SER A 4 ? ? -67.39 -80.62 4 1 HIS A 11 ? ? -137.66 -59.68 5 1 THR A 13 ? ? 73.48 41.87 6 1 THR A 20 ? ? -93.82 58.86 7 1 HIS A 22 ? ? -72.65 -110.88 8 1 CYS A 23 ? ? 174.45 152.11 9 1 MET A 25 ? ? -134.23 -62.34 10 1 SER A 27 ? ? 96.17 35.49 11 2 SER A 4 ? ? -65.68 -77.64 12 2 HIS A 11 ? ? -137.97 -57.32 13 2 THR A 13 ? ? 81.99 37.29 14 2 THR A 20 ? ? -93.78 58.30 15 2 HIS A 22 ? ? -72.82 -110.96 16 2 CYS A 23 ? ? 175.36 156.36 17 2 MET A 25 ? ? -133.03 -59.83 18 2 SER A 27 ? ? 96.58 35.42 19 3 SER A 2 ? ? 68.03 -70.65 20 3 SER A 4 ? ? -91.42 -68.89 21 3 HIS A 11 ? ? -138.03 -60.26 22 3 THR A 13 ? ? 73.44 42.10 23 3 HIS A 22 ? ? -71.45 -110.34 24 3 CYS A 23 ? ? 173.71 147.72 25 3 MET A 25 ? ? -134.44 -63.27 26 3 SER A 27 ? ? 96.93 35.50 27 4 SER A 4 ? ? -83.21 -76.30 28 4 HIS A 11 ? ? -137.83 -58.93 29 4 THR A 13 ? ? 81.52 37.64 30 4 HIS A 22 ? ? -72.29 -110.97 31 4 CYS A 23 ? ? 174.93 154.99 32 4 MET A 25 ? ? -132.79 -60.20 33 4 SER A 27 ? ? 96.86 35.53 34 5 SER A 4 ? ? -82.36 -74.44 35 5 HIS A 11 ? ? -137.72 -59.26 36 5 THR A 13 ? ? 82.00 37.39 37 5 THR A 20 ? ? -93.68 58.41 38 5 HIS A 22 ? ? -72.54 -110.88 39 5 CYS A 23 ? ? 175.27 155.08 40 5 MET A 25 ? ? -132.93 -61.16 41 5 SER A 27 ? ? 97.28 35.49 42 6 SER A 2 ? ? 60.61 103.66 43 6 SER A 4 ? ? -69.02 -78.21 44 6 HIS A 11 ? ? -137.42 -59.12 45 6 THR A 13 ? ? 81.68 37.66 46 6 THR A 20 ? ? -93.62 59.08 47 6 HIS A 22 ? ? -71.98 -110.70 48 6 CYS A 23 ? ? 174.78 153.14 49 6 MET A 25 ? ? -132.65 -60.83 50 6 SER A 27 ? ? 95.56 35.91 51 7 SER A 2 ? ? 60.68 92.88 52 7 SER A 4 ? ? -74.63 -79.67 53 7 HIS A 11 ? ? -137.78 -59.93 54 7 THR A 13 ? ? 73.23 42.36 55 7 HIS A 22 ? ? -71.95 -110.24 56 7 CYS A 23 ? ? 173.73 147.13 57 7 MET A 25 ? ? -134.36 -63.54 58 7 SER A 27 ? ? 97.09 35.36 59 8 THR A 3 ? ? 60.79 111.05 60 8 SER A 4 ? ? -61.24 -75.16 61 8 HIS A 11 ? ? -137.74 -59.44 62 8 THR A 13 ? ? 81.96 37.59 63 8 HIS A 22 ? ? -71.94 -110.78 64 8 CYS A 23 ? ? 174.79 153.71 65 8 MET A 25 ? ? -132.94 -61.82 66 8 SER A 27 ? ? 98.22 35.26 67 9 THR A 3 ? ? 63.48 139.75 68 9 SER A 4 ? ? -82.27 -75.91 69 9 HIS A 11 ? ? -137.82 -59.34 70 9 THR A 13 ? ? 81.93 37.58 71 9 HIS A 22 ? ? -72.15 -110.71 72 9 CYS A 23 ? ? 174.79 153.69 73 9 MET A 25 ? ? -132.98 -61.91 74 9 SER A 27 ? ? 98.40 35.12 75 10 SER A 4 ? ? -86.51 -76.99 76 10 HIS A 11 ? ? -138.49 -59.03 77 10 THR A 13 ? ? 81.72 37.88 78 10 HIS A 22 ? ? -72.37 -110.30 79 10 CYS A 23 ? ? 173.97 148.46 80 10 MET A 25 ? ? -133.57 -61.55 81 10 SER A 27 ? ? 98.46 35.10 82 11 SER A 2 ? ? -60.18 89.13 83 11 THR A 3 ? ? -163.87 115.82 84 11 SER A 4 ? ? -60.17 -166.53 85 11 HIS A 11 ? ? -137.57 -59.72 86 11 THR A 13 ? ? 80.64 38.41 87 11 HIS A 22 ? ? -70.62 -109.31 88 11 CYS A 23 ? ? 173.76 150.31 89 11 MET A 25 ? ? -133.01 -60.57 90 11 SER A 27 ? ? 95.51 35.98 91 12 SER A 4 ? ? -91.84 -76.86 92 12 HIS A 11 ? ? -138.07 -58.90 93 12 THR A 13 ? ? 81.38 38.15 94 12 HIS A 22 ? ? -72.13 -110.42 95 12 CYS A 23 ? ? 173.89 148.02 96 12 MET A 25 ? ? -133.67 -61.49 97 12 SER A 27 ? ? 98.38 35.13 98 13 SER A 4 ? ? -147.42 -71.34 99 13 HIS A 11 ? ? -138.12 -58.44 100 13 THR A 13 ? ? 82.38 37.31 101 13 HIS A 22 ? ? -72.24 -110.85 102 13 CYS A 23 ? ? 174.77 153.28 103 13 MET A 25 ? ? -132.81 -61.05 104 13 SER A 27 ? ? 96.02 36.26 105 14 SER A 4 ? ? -85.17 -76.47 106 14 HIS A 11 ? ? -137.69 -59.37 107 14 THR A 13 ? ? 80.92 38.30 108 14 HIS A 22 ? ? -71.24 -110.40 109 14 CYS A 23 ? ? 173.81 148.50 110 14 MET A 25 ? ? -133.53 -61.18 111 14 SER A 27 ? ? 96.82 36.18 112 15 SER A 2 ? ? 60.47 109.14 113 15 THR A 3 ? ? -176.54 -40.64 114 15 SER A 4 ? ? -179.72 -165.26 115 15 HIS A 11 ? ? -137.64 -59.72 116 15 THR A 13 ? ? 81.19 37.99 117 15 HIS A 22 ? ? -70.82 -110.80 118 15 CYS A 23 ? ? 174.76 154.16 119 15 MET A 25 ? ? -132.13 -59.88 120 15 SER A 27 ? ? 95.30 36.08 121 16 THR A 3 ? ? 60.57 110.68 122 16 SER A 4 ? ? -82.14 -71.02 123 16 HIS A 11 ? ? -137.48 -59.29 124 16 THR A 13 ? ? 81.07 37.90 125 16 HIS A 22 ? ? -71.62 -110.76 126 16 CYS A 23 ? ? 174.60 153.18 127 16 MET A 25 ? ? -132.43 -59.94 128 16 SER A 27 ? ? 95.51 35.86 129 17 THR A 3 ? ? -163.61 119.01 130 17 SER A 4 ? ? -59.80 -170.97 131 17 HIS A 11 ? ? -137.93 -59.86 132 17 THR A 13 ? ? 80.85 38.42 133 17 HIS A 22 ? ? -70.71 -109.31 134 17 CYS A 23 ? ? 173.90 151.40 135 17 MET A 25 ? ? -133.50 -61.11 136 17 SER A 27 ? ? 97.08 35.71 137 18 SER A 2 ? ? -164.68 76.78 138 18 SER A 4 ? ? -155.35 -75.03 139 18 HIS A 11 ? ? -138.47 -58.32 140 18 THR A 13 ? ? 83.01 36.63 141 18 HIS A 22 ? ? -70.83 -109.85 142 18 CYS A 23 ? ? 173.92 158.26 143 18 MET A 25 ? ? -133.02 -61.66 144 18 SER A 27 ? ? 96.50 36.12 145 19 THR A 3 ? ? 62.15 150.88 146 19 SER A 4 ? ? -73.68 -77.90 147 19 HIS A 11 ? ? -137.86 -59.23 148 19 THR A 13 ? ? 80.99 38.33 149 19 HIS A 22 ? ? -71.50 -108.81 150 19 CYS A 23 ? ? 174.00 152.00 151 19 MET A 25 ? ? -133.39 -62.07 152 19 SER A 27 ? ? 98.70 35.49 153 20 SER A 2 ? ? -90.16 -69.33 154 20 THR A 3 ? ? 62.61 119.30 155 20 SER A 4 ? ? -60.05 -76.19 156 20 HIS A 11 ? ? -137.68 -59.15 157 20 THR A 13 ? ? 81.31 37.65 158 20 HIS A 22 ? ? -71.56 -111.07 159 20 CYS A 23 ? ? 174.98 155.70 160 20 MET A 25 ? ? -132.30 -59.76 161 20 SER A 27 ? ? 95.35 36.58 # _pdbx_nmr_ensemble.entry_id 1NJ3 _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1NJ3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM Npl4 NZF domain, U-15N,13C; 20 mM sodium Phosphate, pH 5.5, 50mM NaCl, 5 mM BME,90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 291 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '70 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 HNCACB 2 1 1 'HN(CA)CO' 3 1 1 'H(CCO)NH-TOCSY' 4 1 1 '(H)C(CO)NH-TOCSY' 5 1 1 3D_13C-separated_NOESY 6 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.entry_id 1NJ3 _pdbx_nmr_refine.method 'Torsion Angle Dynamics and Simulated annealing' _pdbx_nmr_refine.details ;Inital structures from Torsion Angle Dynamics (DYANA) were regularized with a gentle annelaing protocol in CNS ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal CNS 1.1 refinement 'BRUNGER, ADAMS, CLORE, DELANO, GROS, GROSSE-KUNSTLEVE, JIANG, KUSZEWSKI, NILGES, PANNU, READ, RICE, SIMONSON, WARREN' 1 DYANA 1.5 refinement 'Guntert, P., Mumenthaler, C., Wuthrich, K.' 2 Felix 97 processing ? 3 Sparky 3.106 'data analysis' ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 HIS N N N N 121 HIS CA C N S 122 HIS C C N N 123 HIS O O N N 124 HIS CB C N N 125 HIS CG C Y N 126 HIS ND1 N Y N 127 HIS CD2 C Y N 128 HIS CE1 C Y N 129 HIS NE2 N Y N 130 HIS OXT O N N 131 HIS H H N N 132 HIS H2 H N N 133 HIS HA H N N 134 HIS HB2 H N N 135 HIS HB3 H N N 136 HIS HD1 H N N 137 HIS HD2 H N N 138 HIS HE1 H N N 139 HIS HE2 H N N 140 HIS HXT H N N 141 LEU N N N N 142 LEU CA C N S 143 LEU C C N N 144 LEU O O N N 145 LEU CB C N N 146 LEU CG C N N 147 LEU CD1 C N N 148 LEU CD2 C N N 149 LEU OXT O N N 150 LEU H H N N 151 LEU H2 H N N 152 LEU HA H N N 153 LEU HB2 H N N 154 LEU HB3 H N N 155 LEU HG H N N 156 LEU HD11 H N N 157 LEU HD12 H N N 158 LEU HD13 H N N 159 LEU HD21 H N N 160 LEU HD22 H N N 161 LEU HD23 H N N 162 LEU HXT H N N 163 MET N N N N 164 MET CA C N S 165 MET C C N N 166 MET O O N N 167 MET CB C N N 168 MET CG C N N 169 MET SD S N N 170 MET CE C N N 171 MET OXT O N N 172 MET H H N N 173 MET H2 H N N 174 MET HA H N N 175 MET HB2 H N N 176 MET HB3 H N N 177 MET HG2 H N N 178 MET HG3 H N N 179 MET HE1 H N N 180 MET HE2 H N N 181 MET HE3 H N N 182 MET HXT H N N 183 PHE N N N N 184 PHE CA C N S 185 PHE C C N N 186 PHE O O N N 187 PHE CB C N N 188 PHE CG C Y N 189 PHE CD1 C Y N 190 PHE CD2 C Y N 191 PHE CE1 C Y N 192 PHE CE2 C Y N 193 PHE CZ C Y N 194 PHE OXT O N N 195 PHE H H N N 196 PHE H2 H N N 197 PHE HA H N N 198 PHE HB2 H N N 199 PHE HB3 H N N 200 PHE HD1 H N N 201 PHE HD2 H N N 202 PHE HE1 H N N 203 PHE HE2 H N N 204 PHE HZ H N N 205 PHE HXT H N N 206 PRO N N N N 207 PRO CA C N S 208 PRO C C N N 209 PRO O O N N 210 PRO CB C N N 211 PRO CG C N N 212 PRO CD C N N 213 PRO OXT O N N 214 PRO H H N N 215 PRO HA H N N 216 PRO HB2 H N N 217 PRO HB3 H N N 218 PRO HG2 H N N 219 PRO HG3 H N N 220 PRO HD2 H N N 221 PRO HD3 H N N 222 PRO HXT H N N 223 SER N N N N 224 SER CA C N S 225 SER C C N N 226 SER O O N N 227 SER CB C N N 228 SER OG O N N 229 SER OXT O N N 230 SER H H N N 231 SER H2 H N N 232 SER HA H N N 233 SER HB2 H N N 234 SER HB3 H N N 235 SER HG H N N 236 SER HXT H N N 237 THR N N N N 238 THR CA C N S 239 THR C C N N 240 THR O O N N 241 THR CB C N R 242 THR OG1 O N N 243 THR CG2 C N N 244 THR OXT O N N 245 THR H H N N 246 THR H2 H N N 247 THR HA H N N 248 THR HB H N N 249 THR HG1 H N N 250 THR HG21 H N N 251 THR HG22 H N N 252 THR HG23 H N N 253 THR HXT H N N 254 TRP N N N N 255 TRP CA C N S 256 TRP C C N N 257 TRP O O N N 258 TRP CB C N N 259 TRP CG C Y N 260 TRP CD1 C Y N 261 TRP CD2 C Y N 262 TRP NE1 N Y N 263 TRP CE2 C Y N 264 TRP CE3 C Y N 265 TRP CZ2 C Y N 266 TRP CZ3 C Y N 267 TRP CH2 C Y N 268 TRP OXT O N N 269 TRP H H N N 270 TRP H2 H N N 271 TRP HA H N N 272 TRP HB2 H N N 273 TRP HB3 H N N 274 TRP HD1 H N N 275 TRP HE1 H N N 276 TRP HE3 H N N 277 TRP HZ2 H N N 278 TRP HZ3 H N N 279 TRP HH2 H N N 280 TRP HXT H N N 281 ZN ZN ZN N N 282 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 HIS N CA sing N N 114 HIS N H sing N N 115 HIS N H2 sing N N 116 HIS CA C sing N N 117 HIS CA CB sing N N 118 HIS CA HA sing N N 119 HIS C O doub N N 120 HIS C OXT sing N N 121 HIS CB CG sing N N 122 HIS CB HB2 sing N N 123 HIS CB HB3 sing N N 124 HIS CG ND1 sing Y N 125 HIS CG CD2 doub Y N 126 HIS ND1 CE1 doub Y N 127 HIS ND1 HD1 sing N N 128 HIS CD2 NE2 sing Y N 129 HIS CD2 HD2 sing N N 130 HIS CE1 NE2 sing Y N 131 HIS CE1 HE1 sing N N 132 HIS NE2 HE2 sing N N 133 HIS OXT HXT sing N N 134 LEU N CA sing N N 135 LEU N H sing N N 136 LEU N H2 sing N N 137 LEU CA C sing N N 138 LEU CA CB sing N N 139 LEU CA HA sing N N 140 LEU C O doub N N 141 LEU C OXT sing N N 142 LEU CB CG sing N N 143 LEU CB HB2 sing N N 144 LEU CB HB3 sing N N 145 LEU CG CD1 sing N N 146 LEU CG CD2 sing N N 147 LEU CG HG sing N N 148 LEU CD1 HD11 sing N N 149 LEU CD1 HD12 sing N N 150 LEU CD1 HD13 sing N N 151 LEU CD2 HD21 sing N N 152 LEU CD2 HD22 sing N N 153 LEU CD2 HD23 sing N N 154 LEU OXT HXT sing N N 155 MET N CA sing N N 156 MET N H sing N N 157 MET N H2 sing N N 158 MET CA C sing N N 159 MET CA CB sing N N 160 MET CA HA sing N N 161 MET C O doub N N 162 MET C OXT sing N N 163 MET CB CG sing N N 164 MET CB HB2 sing N N 165 MET CB HB3 sing N N 166 MET CG SD sing N N 167 MET CG HG2 sing N N 168 MET CG HG3 sing N N 169 MET SD CE sing N N 170 MET CE HE1 sing N N 171 MET CE HE2 sing N N 172 MET CE HE3 sing N N 173 MET OXT HXT sing N N 174 PHE N CA sing N N 175 PHE N H sing N N 176 PHE N H2 sing N N 177 PHE CA C sing N N 178 PHE CA CB sing N N 179 PHE CA HA sing N N 180 PHE C O doub N N 181 PHE C OXT sing N N 182 PHE CB CG sing N N 183 PHE CB HB2 sing N N 184 PHE CB HB3 sing N N 185 PHE CG CD1 doub Y N 186 PHE CG CD2 sing Y N 187 PHE CD1 CE1 sing Y N 188 PHE CD1 HD1 sing N N 189 PHE CD2 CE2 doub Y N 190 PHE CD2 HD2 sing N N 191 PHE CE1 CZ doub Y N 192 PHE CE1 HE1 sing N N 193 PHE CE2 CZ sing Y N 194 PHE CE2 HE2 sing N N 195 PHE CZ HZ sing N N 196 PHE OXT HXT sing N N 197 PRO N CA sing N N 198 PRO N CD sing N N 199 PRO N H sing N N 200 PRO CA C sing N N 201 PRO CA CB sing N N 202 PRO CA HA sing N N 203 PRO C O doub N N 204 PRO C OXT sing N N 205 PRO CB CG sing N N 206 PRO CB HB2 sing N N 207 PRO CB HB3 sing N N 208 PRO CG CD sing N N 209 PRO CG HG2 sing N N 210 PRO CG HG3 sing N N 211 PRO CD HD2 sing N N 212 PRO CD HD3 sing N N 213 PRO OXT HXT sing N N 214 SER N CA sing N N 215 SER N H sing N N 216 SER N H2 sing N N 217 SER CA C sing N N 218 SER CA CB sing N N 219 SER CA HA sing N N 220 SER C O doub N N 221 SER C OXT sing N N 222 SER CB OG sing N N 223 SER CB HB2 sing N N 224 SER CB HB3 sing N N 225 SER OG HG sing N N 226 SER OXT HXT sing N N 227 THR N CA sing N N 228 THR N H sing N N 229 THR N H2 sing N N 230 THR CA C sing N N 231 THR CA CB sing N N 232 THR CA HA sing N N 233 THR C O doub N N 234 THR C OXT sing N N 235 THR CB OG1 sing N N 236 THR CB CG2 sing N N 237 THR CB HB sing N N 238 THR OG1 HG1 sing N N 239 THR CG2 HG21 sing N N 240 THR CG2 HG22 sing N N 241 THR CG2 HG23 sing N N 242 THR OXT HXT sing N N 243 TRP N CA sing N N 244 TRP N H sing N N 245 TRP N H2 sing N N 246 TRP CA C sing N N 247 TRP CA CB sing N N 248 TRP CA HA sing N N 249 TRP C O doub N N 250 TRP C OXT sing N N 251 TRP CB CG sing N N 252 TRP CB HB2 sing N N 253 TRP CB HB3 sing N N 254 TRP CG CD1 doub Y N 255 TRP CG CD2 sing Y N 256 TRP CD1 NE1 sing Y N 257 TRP CD1 HD1 sing N N 258 TRP CD2 CE2 doub Y N 259 TRP CD2 CE3 sing Y N 260 TRP NE1 CE2 sing Y N 261 TRP NE1 HE1 sing N N 262 TRP CE2 CZ2 sing Y N 263 TRP CE3 CZ3 doub Y N 264 TRP CE3 HE3 sing N N 265 TRP CZ2 CH2 doub Y N 266 TRP CZ2 HZ2 sing N N 267 TRP CZ3 CH2 sing Y N 268 TRP CZ3 HZ3 sing N N 269 TRP CH2 HH2 sing N N 270 TRP OXT HXT sing N N 271 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian UNITYPLUS 500 # _atom_sites.entry_id 1NJ3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_