data_1NSP # _entry.id 1NSP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1NSP WWPDB D_1000175391 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NSP _pdbx_database_status.recvd_initial_deposition_date 1995-04-18 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Janin, J.' 1 'Morera, S.' 2 'Chiadmi, M.' 3 'Lebras, G.' 4 'Lascu, I.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Mechanism of phosphate transfer by nucleoside diphosphate kinase: X-ray structures of the phosphohistidine intermediate of the enzymes from Drosophila and Dictyostelium. ; Biochemistry 34 11062 11070 1995 BICHAW US 0006-2960 0033 ? 7669763 10.1021/bi00035a011 1 'Refined X-Ray Structure of Dictyostelium Discoideum Nucleoside Diphosphate Kinase at 1.8 Angstroms Resolution' J.Mol.Biol. 243 873 ? 1994 JMOBAK UK 0022-2836 0070 ? ? ? 2 'X-Ray Structure of Nucleoside Diphosphate Kinase' 'Embo J.' 11 3203 ? 1992 EMJODG UK 0261-4189 0897 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Morera, S.' 1 primary 'Chiadmi, M.' 2 primary 'LeBras, G.' 3 primary 'Lascu, I.' 4 primary 'Janin, J.' 5 1 'Morera, S.' 6 1 'Lebras, G.' 7 1 'Lascu, I.' 8 1 'Lacombe, M.L.' 9 1 'Veron, M.' 10 1 'Janin, J.' 11 2 'Dumas, C.' 12 2 'Lascu, I.' 13 2 'Morera, S.' 14 2 'Glaser, P.' 15 2 'Fourme, R.' 16 2 'Wallet, V.' 17 2 'Lacombe, M.L.' 18 2 'Veron, M.' 19 2 'Janin, J.' 20 # _cell.entry_id 1NSP _cell.length_a 75.160 _cell.length_b 75.160 _cell.length_c 105.930 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NSP _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NUCLEOSIDE DIPHOSPHATE KINASE' 16896.316 1 2.7.4.6 ? ? ? 2 water nat water 18.015 81 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAM VFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNII(HIP)GSDSVESANREIALWFKPEELLTEVKPNPNLYE ; _entity_poly.pdbx_seq_one_letter_code_can ;MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAM VFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 THR n 1 4 ASN n 1 5 LYS n 1 6 VAL n 1 7 ASN n 1 8 LYS n 1 9 GLU n 1 10 ARG n 1 11 THR n 1 12 PHE n 1 13 LEU n 1 14 ALA n 1 15 VAL n 1 16 LYS n 1 17 PRO n 1 18 ASP n 1 19 GLY n 1 20 VAL n 1 21 ALA n 1 22 ARG n 1 23 GLY n 1 24 LEU n 1 25 VAL n 1 26 GLY n 1 27 GLU n 1 28 ILE n 1 29 ILE n 1 30 ALA n 1 31 ARG n 1 32 TYR n 1 33 GLU n 1 34 LYS n 1 35 LYS n 1 36 GLY n 1 37 PHE n 1 38 VAL n 1 39 LEU n 1 40 VAL n 1 41 GLY n 1 42 LEU n 1 43 LYS n 1 44 GLN n 1 45 LEU n 1 46 VAL n 1 47 PRO n 1 48 THR n 1 49 LYS n 1 50 ASP n 1 51 LEU n 1 52 ALA n 1 53 GLU n 1 54 SER n 1 55 HIS n 1 56 TYR n 1 57 ALA n 1 58 GLU n 1 59 HIS n 1 60 LYS n 1 61 GLU n 1 62 ARG n 1 63 PRO n 1 64 PHE n 1 65 PHE n 1 66 GLY n 1 67 GLY n 1 68 LEU n 1 69 VAL n 1 70 SER n 1 71 PHE n 1 72 ILE n 1 73 THR n 1 74 SER n 1 75 GLY n 1 76 PRO n 1 77 VAL n 1 78 VAL n 1 79 ALA n 1 80 MET n 1 81 VAL n 1 82 PHE n 1 83 GLU n 1 84 GLY n 1 85 LYS n 1 86 GLY n 1 87 VAL n 1 88 VAL n 1 89 ALA n 1 90 SER n 1 91 ALA n 1 92 ARG n 1 93 LEU n 1 94 MET n 1 95 ILE n 1 96 GLY n 1 97 VAL n 1 98 THR n 1 99 ASN n 1 100 PRO n 1 101 LEU n 1 102 ALA n 1 103 SER n 1 104 ALA n 1 105 PRO n 1 106 GLY n 1 107 SER n 1 108 ILE n 1 109 ARG n 1 110 GLY n 1 111 ASP n 1 112 PHE n 1 113 GLY n 1 114 VAL n 1 115 ASP n 1 116 VAL n 1 117 GLY n 1 118 ARG n 1 119 ASN n 1 120 ILE n 1 121 ILE n 1 122 HIP n 1 123 GLY n 1 124 SER n 1 125 ASP n 1 126 SER n 1 127 VAL n 1 128 GLU n 1 129 SER n 1 130 ALA n 1 131 ASN n 1 132 ARG n 1 133 GLU n 1 134 ILE n 1 135 ALA n 1 136 LEU n 1 137 TRP n 1 138 PHE n 1 139 LYS n 1 140 PRO n 1 141 GLU n 1 142 GLU n 1 143 LEU n 1 144 LEU n 1 145 THR n 1 146 GLU n 1 147 VAL n 1 148 LYS n 1 149 PRO n 1 150 ASN n 1 151 PRO n 1 152 ASN n 1 153 LEU n 1 154 TYR n 1 155 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Dictyostelium _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Dictyostelium discoideum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 44689 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NDKC_DICDI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P22887 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAM VFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NSP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 155 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22887 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 155 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 155 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIP 'L-peptide linking' n ND1-PHOSPHONOHISTIDINE ? 'C6 H11 N3 O5 P 1' 236.142 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1NSP _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_percent_sol 51.85 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _reflns.entry_id 1NSP _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.1 _reflns.number_obs 10810 _reflns.number_all ? _reflns.percent_possible_obs 97. _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 1NSP _refine.ls_number_reflns_obs 10663 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8 _refine.ls_d_res_high 2.1 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.188 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.188 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1151 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 81 _refine_hist.number_atoms_total 1232 _refine_hist.d_res_high 2.1 _refine_hist.d_res_low 8 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.014 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.67 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1NSP _struct.title ;MECHANISM OF PHOSPHATE TRANSFER BY NUCLEOSIDE DIPHOSPHATE KINASE: X-RAY STRUCTURES OF A PHOSPHO-HISTIDINE INTERMEDIATE OF THE ENZYMES FROM DROSOPHILA AND DICTYOSTELIUM ; _struct.pdbx_descriptor 'NUCLEOSIDE DIPHOSPHATE KINASE (E.C.2.7.4.6)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NSP _struct_keywords.pdbx_keywords PHOSPHOTRANSFERASE _struct_keywords.text 'NUCLEOSIDE TRIPHOSPHATE: NUCLEOSIDE DIPHOSPHATE, PHOSPHOTRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A0 PRO A 17 ? ALA A 21 ? PRO A 17 ALA A 21 1 '3/10: 3/10 HELIX' 5 HELX_P HELX_P2 A1 VAL A 25 ? LYS A 35 ? VAL A 25 LYS A 35 1 'PP: POLYPROLINE II' 11 HELX_P HELX_P3 AA LYS A 49 ? HIS A 55 ? LYS A 49 HIS A 55 1 ? 7 HELX_P HELX_P4 310 ALA A 57 ? HIS A 59 ? ALA A 57 HIS A 59 5 ? 3 HELX_P HELX_P5 A2 PHE A 65 ? THR A 73 ? PHE A 65 THR A 73 1 ? 9 HELX_P HELX_P6 A3 VAL A 87 ? ILE A 95 ? VAL A 87 ILE A 95 1 ? 9 HELX_P HELX_P7 310 PRO A 100 ? ALA A 102 ? PRO A 100 ALA A 102 5 ? 3 HELX_P HELX_P8 PP SER A 103 ? PRO A 105 ? SER A 103 PRO A 105 10 ? 3 HELX_P HELX_P9 "A'3" ILE A 108 ? PHE A 112 ? ILE A 108 PHE A 112 1 ? 5 HELX_P HELX_P10 A4 VAL A 127 ? TRP A 137 ? VAL A 127 TRP A 137 1 ? 11 HELX_P HELX_P11 310 PRO A 140 ? GLU A 142 ? PRO A 140 GLU A 142 5 ? 3 HELX_P HELX_P12 PP GLU A 146 ? ASN A 150 ? GLU A 146 ASN A 150 10 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ILE 121 C ? ? ? 1_555 A HIP 122 N ? ? A ILE 121 A HIP 122 1_555 ? ? ? ? ? ? ? 1.332 ? covale2 covale ? ? A HIP 122 C ? ? ? 1_555 A GLY 123 N ? ? A HIP 122 A GLY 123 1_555 ? ? ? ? ? ? ? 1.334 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id BET _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense BET 1 2 ? parallel BET 2 3 ? parallel BET 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id BET 1 GLU A 9 ? LYS A 16 ? GLU A 9 LYS A 16 BET 2 VAL A 38 ? LEU A 45 ? VAL A 38 LEU A 45 BET 3 VAL A 77 ? GLU A 83 ? VAL A 77 GLU A 83 BET 4 ILE A 121 ? SER A 124 ? ILE A 121 SER A 124 # _database_PDB_matrix.entry_id 1NSP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NSP _atom_sites.fract_transf_matrix[1][1] 0.013305 _atom_sites.fract_transf_matrix[1][2] 0.007682 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015363 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009440 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 ASN 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 HIP 122 122 122 HIP HIS A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 TRP 137 137 137 TRP TRP A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 GLU 155 155 155 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 200 200 HOH HOH A . B 2 HOH 2 201 201 HOH HOH A . B 2 HOH 3 202 202 HOH HOH A . B 2 HOH 4 203 203 HOH HOH A . B 2 HOH 5 204 204 HOH HOH A . B 2 HOH 6 205 205 HOH HOH A . B 2 HOH 7 206 206 HOH HOH A . B 2 HOH 8 207 207 HOH HOH A . B 2 HOH 9 208 208 HOH HOH A . B 2 HOH 10 209 209 HOH HOH A . B 2 HOH 11 210 210 HOH HOH A . B 2 HOH 12 211 211 HOH HOH A . B 2 HOH 13 212 212 HOH HOH A . B 2 HOH 14 213 213 HOH HOH A . B 2 HOH 15 214 214 HOH HOH A . B 2 HOH 16 215 215 HOH HOH A . B 2 HOH 17 216 216 HOH HOH A . B 2 HOH 18 217 217 HOH HOH A . B 2 HOH 19 218 218 HOH HOH A . B 2 HOH 20 219 219 HOH HOH A . B 2 HOH 21 220 220 HOH HOH A . B 2 HOH 22 221 221 HOH HOH A . B 2 HOH 23 222 222 HOH HOH A . B 2 HOH 24 223 223 HOH HOH A . B 2 HOH 25 224 224 HOH HOH A . B 2 HOH 26 225 225 HOH HOH A . B 2 HOH 27 226 226 HOH HOH A . B 2 HOH 28 227 227 HOH HOH A . B 2 HOH 29 228 228 HOH HOH A . B 2 HOH 30 229 229 HOH HOH A . B 2 HOH 31 230 230 HOH HOH A . B 2 HOH 32 231 231 HOH HOH A . B 2 HOH 33 232 232 HOH HOH A . B 2 HOH 34 233 233 HOH HOH A . B 2 HOH 35 234 234 HOH HOH A . B 2 HOH 36 235 235 HOH HOH A . B 2 HOH 37 236 236 HOH HOH A . B 2 HOH 38 237 237 HOH HOH A . B 2 HOH 39 238 238 HOH HOH A . B 2 HOH 40 239 239 HOH HOH A . B 2 HOH 41 240 240 HOH HOH A . B 2 HOH 42 241 241 HOH HOH A . B 2 HOH 43 242 242 HOH HOH A . B 2 HOH 44 243 243 HOH HOH A . B 2 HOH 45 244 244 HOH HOH A . B 2 HOH 46 245 245 HOH HOH A . B 2 HOH 47 246 246 HOH HOH A . B 2 HOH 48 247 247 HOH HOH A . B 2 HOH 49 248 248 HOH HOH A . B 2 HOH 50 249 249 HOH HOH A . B 2 HOH 51 250 250 HOH HOH A . B 2 HOH 52 251 251 HOH HOH A . B 2 HOH 53 252 252 HOH HOH A . B 2 HOH 54 253 253 HOH HOH A . B 2 HOH 55 254 254 HOH HOH A . B 2 HOH 56 255 255 HOH HOH A . B 2 HOH 57 256 256 HOH HOH A . B 2 HOH 58 257 257 HOH HOH A . B 2 HOH 59 258 258 HOH HOH A . B 2 HOH 60 259 259 HOH HOH A . B 2 HOH 61 261 261 HOH HOH A . B 2 HOH 62 262 262 HOH HOH A . B 2 HOH 63 263 263 HOH HOH A . B 2 HOH 64 264 264 HOH HOH A . B 2 HOH 65 265 265 HOH HOH A . B 2 HOH 66 266 266 HOH HOH A . B 2 HOH 67 267 267 HOH HOH A . B 2 HOH 68 268 268 HOH HOH A . B 2 HOH 69 269 269 HOH HOH A . B 2 HOH 70 270 270 HOH HOH A . B 2 HOH 71 271 271 HOH HOH A . B 2 HOH 72 273 273 HOH HOH A . B 2 HOH 73 274 274 HOH HOH A . B 2 HOH 74 275 275 HOH HOH A . B 2 HOH 75 277 277 HOH HOH A . B 2 HOH 76 278 278 HOH HOH A . B 2 HOH 77 279 279 HOH HOH A . B 2 HOH 78 280 280 HOH HOH A . B 2 HOH 79 281 281 HOH HOH A . B 2 HOH 80 282 282 HOH HOH A . B 2 HOH 81 283 283 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id HIP _pdbx_struct_mod_residue.label_seq_id 122 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id HIP _pdbx_struct_mod_residue.auth_seq_id 122 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id HIS _pdbx_struct_mod_residue.details ND1-PHOSPHONOHISTIDINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 12630 ? 1 MORE -60 ? 1 'SSA (A^2)' 34670 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 37.5800000000 0.8660254038 -0.5000000000 0.0000000000 65.0904693484 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -37.5800000000 -0.8660254038 -0.5000000000 0.0000000000 65.0904693484 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/2 0.5000000000 -0.8660254038 0.0000000000 37.5800000000 -0.8660254038 -0.5000000000 0.0000000000 65.0904693484 0.0000000000 0.0000000000 -1.0000000000 52.9650000000 5 'crystal symmetry operation' 11_555 -x+y,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 52.9650000000 6 'crystal symmetry operation' 12_565 x,x-y+1,-z+1/2 0.5000000000 0.8660254038 0.0000000000 -37.5800000000 0.8660254038 -0.5000000000 0.0000000000 65.0904693484 0.0000000000 0.0000000000 -1.0000000000 52.9650000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-07-10 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement 0 ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 43 ? ? -170.05 147.21 2 1 ILE A 120 ? ? 68.66 -50.33 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A ASN 4 ? A ASN 4 5 1 Y 1 A LYS 5 ? A LYS 5 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #