data_1OD3 # _entry.id 1OD3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.382 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1OD3 pdb_00001od3 10.2210/pdb1od3/pdb PDBE EBI-12176 ? ? WWPDB D_1290012176 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1O8P unspecified 'UNBOUND STRUCTURE OF CSCBM6-3 FROM CLOSTRIDIUM STERCORARIUM' PDB 1O8S unspecified 'STRUCTURE OF CSCBM6-3 FROM CLOSTRIDIUM STERCORARIUM IN COMPLEX WITH CELLOBIOSE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1OD3 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2003-02-12 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Boraston, A.B.' 1 'Notenboom, V.' 2 'Warren, R.A.J.' 3 'Kilburn, D.G.' 4 'Rose, D.R.' 5 'Davies, G.J.' 6 # _citation.id primary _citation.title ;Structure and Ligand Binding of Carbohydrate-Binding Module Cscbm6-3 Reveals Similarities with Fucose-Specific Lectins and Galactose-Binding Domains ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 327 _citation.page_first 659 _citation.page_last ? _citation.year 2003 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12634060 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(03)00152-9' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Boraston, A.B.' 1 ? primary 'Notenboom, V.' 2 ? primary 'Warren, R.A.J.' 3 ? primary 'Kilburn, D.G.' 4 ? primary 'Rose, D.R.' 5 ? primary 'Davies, G.J.' 6 ? # _cell.entry_id 1OD3 _cell.length_a 36.183 _cell.length_b 52.154 _cell.length_c 64.755 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1OD3 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PUTATIVE XYLANASE' 17405.947 1 ? ? 'CARBOHYDRATE-BINDING DOMAIN, RESIDUES 285-417' ? 2 branched man 'beta-D-glucopyranose-(1-3)-beta-D-glucopyranose' 342.297 2 ? ? ? ? 3 non-polymer syn 'ACETIC ACID' 60.052 1 ? ? ? ? 4 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 5 water nat water 18.015 273 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'ENDO-XYLANASE, CSCBM6-3, XYNA' 2 beta-laminaribiose # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYST TYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDW FVFSKSGT ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYST TYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDW FVFSKSGT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 SER n 1 24 THR n 1 25 PRO n 1 26 ALA n 1 27 ASN n 1 28 VAL n 1 29 ASN n 1 30 SER n 1 31 GLY n 1 32 PRO n 1 33 THR n 1 34 SER n 1 35 PRO n 1 36 VAL n 1 37 GLY n 1 38 GLY n 1 39 THR n 1 40 ARG n 1 41 SER n 1 42 ALA n 1 43 PHE n 1 44 SER n 1 45 ASN n 1 46 ILE n 1 47 GLN n 1 48 ALA n 1 49 GLU n 1 50 ASP n 1 51 TYR n 1 52 ASP n 1 53 SER n 1 54 SER n 1 55 TYR n 1 56 GLY n 1 57 PRO n 1 58 ASN n 1 59 LEU n 1 60 GLN n 1 61 ILE n 1 62 PHE n 1 63 SER n 1 64 LEU n 1 65 PRO n 1 66 GLY n 1 67 GLY n 1 68 GLY n 1 69 SER n 1 70 ALA n 1 71 ILE n 1 72 GLY n 1 73 TYR n 1 74 ILE n 1 75 GLU n 1 76 ASN n 1 77 GLY n 1 78 TYR n 1 79 SER n 1 80 THR n 1 81 THR n 1 82 TYR n 1 83 LYS n 1 84 ASN n 1 85 ILE n 1 86 ASP n 1 87 PHE n 1 88 GLY n 1 89 ASP n 1 90 GLY n 1 91 ALA n 1 92 THR n 1 93 SER n 1 94 VAL n 1 95 THR n 1 96 ALA n 1 97 ARG n 1 98 VAL n 1 99 ALA n 1 100 THR n 1 101 GLN n 1 102 ASN n 1 103 ALA n 1 104 THR n 1 105 THR n 1 106 ILE n 1 107 GLN n 1 108 VAL n 1 109 ARG n 1 110 LEU n 1 111 GLY n 1 112 SER n 1 113 PRO n 1 114 SER n 1 115 GLY n 1 116 THR n 1 117 LEU n 1 118 LEU n 1 119 GLY n 1 120 THR n 1 121 ILE n 1 122 TYR n 1 123 VAL n 1 124 GLY n 1 125 SER n 1 126 THR n 1 127 GLY n 1 128 SER n 1 129 PHE n 1 130 ASP n 1 131 THR n 1 132 TYR n 1 133 ARG n 1 134 ASP n 1 135 VAL n 1 136 SER n 1 137 ALA n 1 138 THR n 1 139 ILE n 1 140 SER n 1 141 ASN n 1 142 THR n 1 143 ALA n 1 144 GLY n 1 145 VAL n 1 146 LYS n 1 147 ASP n 1 148 ILE n 1 149 VAL n 1 150 LEU n 1 151 VAL n 1 152 PHE n 1 153 SER n 1 154 GLY n 1 155 PRO n 1 156 VAL n 1 157 ASN n 1 158 VAL n 1 159 ASP n 1 160 TRP n 1 161 PHE n 1 162 VAL n 1 163 PHE n 1 164 SER n 1 165 LYS n 1 166 SER n 1 167 GLY n 1 168 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'CLOSTRIDIUM STERCORARIUM' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1510 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET28 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28-CBM6-3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 1OD3 1 ? ? 1OD3 ? 2 UNP Q93AQ5 1 ? ? Q93AQ5 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1OD3 A 1 ? 35 ? 1OD3 -16 ? 18 ? -16 18 2 2 1OD3 A 36 ? 168 ? Q93AQ5 285 ? 417 ? 19 151 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACY non-polymer . 'ACETIC ACID' ? 'C2 H4 O2' 60.052 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BGC 'D-saccharide, beta linking' . beta-D-glucopyranose 'beta-D-glucose; D-glucose; glucose' 'C6 H12 O6' 180.156 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1OD3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.76 _exptl_crystal.density_percent_sol 29.92 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.60 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 4.60' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-1' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-1 _diffrn_source.pdbx_wavelength 0.934 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1OD3 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 40.000 _reflns.d_resolution_high 1.000 _reflns.number_obs 61302 _reflns.number_all ? _reflns.percent_possible_obs 97.2 _reflns.pdbx_Rmerge_I_obs 0.05300 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 17.8000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.500 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.00 _reflns_shell.d_res_low 1.06 _reflns_shell.percent_possible_all 94.2 _reflns_shell.Rmerge_I_obs 0.40900 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.300 _reflns_shell.pdbx_redundancy 4.20 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1OD3 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 61302 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.49 _refine.ls_d_res_high 1.00 _refine.ls_percent_reflns_obs 96.9 _refine.ls_R_factor_obs 0.132 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.131 _refine.ls_R_factor_R_free 0.149 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 3282 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.980 _refine.correlation_coeff_Fo_to_Fc_free 0.975 _refine.B_iso_mean 8.45 _refine.aniso_B[1][1] -0.30000 _refine.aniso_B[2][2] 0.21000 _refine.aniso_B[3][3] 0.09000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 1NAE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.022 _refine.pdbx_overall_ESU_R_Free 0.023 _refine.overall_SU_ML 0.015 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 0.275 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 966 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 51 _refine_hist.number_atoms_solvent 273 _refine_hist.number_atoms_total 1290 _refine_hist.d_res_high 1.00 _refine_hist.d_res_low 40.49 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.021 ? 1085 'X-RAY DIFFRACTION' ? r_bond_other_d 0.003 0.020 ? 921 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.007 1.988 ? 1476 'X-RAY DIFFRACTION' ? r_angle_other_deg 3.958 3.000 ? 2156 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.763 5.000 ? 130 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_chiral_restr 0.116 0.200 ? 176 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.010 0.020 ? 1178 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 222 'X-RAY DIFFRACTION' ? r_nbd_refined 0.328 0.200 ? 197 'X-RAY DIFFRACTION' ? r_nbd_other 0.293 0.200 ? 1097 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other 0.136 0.200 ? 654 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.257 0.200 ? 188 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined 0.075 0.000 ? 4 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.321 0.200 ? 17 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.318 0.200 ? 58 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.311 0.200 ? 53 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.848 2.000 ? 645 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.568 3.000 ? 1051 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.653 2.000 ? 440 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.749 3.000 ? 425 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.00 _refine_ls_shell.d_res_low 1.03 _refine_ls_shell.number_reflns_R_work 4330 _refine_ls_shell.R_factor_R_work 0.3440 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.3360 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 206 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 1OD3 _struct.title 'Structure of CSCBM6-3 From Clostridium stercorarium in complex with laminaribiose' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1OD3 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'HYDROLASE, CARBOHYDRATE BINDING MODULE, BETA-SANDWICH, LAMINARIBIOSE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B BGC . O3 ? ? ? 1_555 B BGC . C1 ? ? B BGC 1 B BGC 2 1_555 ? ? ? ? ? ? ? 1.433 ? ? covale2 covale both ? C BGC . O3 ? ? ? 1_555 C BGC . C1 ? ? C BGC 1 C BGC 2 1_555 ? ? ? ? ? ? ? 1.431 ? ? metalc1 metalc ? ? A GLN 47 OE1 ? ? ? 1_555 E CA . CA ? ? A GLN 30 A CA 1153 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc2 metalc ? ? A SER 69 O ? ? ? 1_555 E CA . CA ? ? A SER 52 A CA 1153 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc3 metalc ? ? A ASP 159 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 142 A CA 1153 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc4 metalc ? ? A ASP 159 O ? ? ? 1_555 E CA . CA ? ? A ASP 142 A CA 1153 1_555 ? ? ? ? ? ? ? 2.417 ? ? metalc5 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1153 A HOH 2035 1_555 ? ? ? ? ? ? ? 2.446 ? ? metalc6 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1153 A HOH 2040 1_555 ? ? ? ? ? ? ? 2.439 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 3 ? AB ? 5 ? AC ? 4 ? AD ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? anti-parallel AB 1 2 ? parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel AC 3 4 ? anti-parallel AD 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ARG A 40 ? SER A 41 ? ARG A 23 SER A 24 AA 2 SER A 79 ? ASP A 86 ? SER A 62 ASP A 69 AA 3 SER A 53 ? TYR A 55 ? SER A 36 TYR A 38 AB 1 ARG A 40 ? SER A 41 ? ARG A 23 SER A 24 AB 2 SER A 79 ? ASP A 86 ? SER A 62 ASP A 69 AB 3 VAL A 145 ? PHE A 152 ? VAL A 128 PHE A 135 AB 4 THR A 104 ? LEU A 110 ? THR A 87 LEU A 93 AB 5 LEU A 117 ? VAL A 123 ? LEU A 100 VAL A 106 AC 1 ILE A 46 ? GLN A 47 ? ILE A 29 GLN A 30 AC 2 ASN A 157 ? SER A 164 ? ASN A 140 SER A 147 AC 3 ALA A 91 ? ALA A 99 ? ALA A 74 ALA A 82 AC 4 ARG A 133 ? THR A 142 ? ARG A 116 THR A 125 AD 1 GLN A 60 ? SER A 63 ? GLN A 43 SER A 46 AD 2 SER A 69 ? GLY A 72 ? SER A 52 GLY A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ARG A 40 ? N ARG A 23 O ASN A 84 ? O ASN A 67 AA 2 3 N THR A 81 ? N THR A 64 O SER A 53 ? O SER A 36 AB 1 2 N ARG A 40 ? N ARG A 23 O ASN A 84 ? O ASN A 67 AB 2 3 N ILE A 85 ? N ILE A 68 O LYS A 146 ? O LYS A 129 AB 3 4 N VAL A 151 ? N VAL A 134 O GLN A 107 ? O GLN A 90 AB 4 5 O VAL A 108 ? O VAL A 91 N LEU A 118 ? N LEU A 101 AC 1 2 N ILE A 46 ? N ILE A 29 O PHE A 161 ? O PHE A 144 AC 2 3 O SER A 164 ? O SER A 147 N THR A 92 ? N THR A 75 AC 3 4 N VAL A 98 ? N VAL A 81 O ARG A 133 ? O ARG A 116 AD 1 2 N PHE A 62 ? N PHE A 45 O ALA A 70 ? O ALA A 53 # _database_PDB_matrix.entry_id 1OD3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1OD3 _atom_sites.fract_transf_matrix[1][1] 0.027637 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019174 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015443 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -16 ? ? ? A . n A 1 2 GLY 2 -15 ? ? ? A . n A 1 3 SER 3 -14 ? ? ? A . n A 1 4 SER 4 -13 ? ? ? A . n A 1 5 HIS 5 -12 ? ? ? A . n A 1 6 HIS 6 -11 ? ? ? A . n A 1 7 HIS 7 -10 ? ? ? A . n A 1 8 HIS 8 -9 ? ? ? A . n A 1 9 HIS 9 -8 ? ? ? A . n A 1 10 HIS 10 -7 ? ? ? A . n A 1 11 SER 11 -6 ? ? ? A . n A 1 12 SER 12 -5 ? ? ? A . n A 1 13 GLY 13 -4 ? ? ? A . n A 1 14 LEU 14 -3 ? ? ? A . n A 1 15 VAL 15 -2 ? ? ? A . n A 1 16 PRO 16 -1 ? ? ? A . n A 1 17 ARG 17 0 ? ? ? A . n A 1 18 GLY 18 1 ? ? ? A . n A 1 19 SER 19 2 ? ? ? A . n A 1 20 HIS 20 3 ? ? ? A . n A 1 21 MET 21 4 ? ? ? A . n A 1 22 ALA 22 5 ? ? ? A . n A 1 23 SER 23 6 ? ? ? A . n A 1 24 THR 24 7 ? ? ? A . n A 1 25 PRO 25 8 ? ? ? A . n A 1 26 ALA 26 9 ? ? ? A . n A 1 27 ASN 27 10 ? ? ? A . n A 1 28 VAL 28 11 ? ? ? A . n A 1 29 ASN 29 12 ? ? ? A . n A 1 30 SER 30 13 ? ? ? A . n A 1 31 GLY 31 14 ? ? ? A . n A 1 32 PRO 32 15 ? ? ? A . n A 1 33 THR 33 16 ? ? ? A . n A 1 34 SER 34 17 ? ? ? A . n A 1 35 PRO 35 18 ? ? ? A . n A 1 36 VAL 36 19 19 VAL VAL A . n A 1 37 GLY 37 20 20 GLY GLY A . n A 1 38 GLY 38 21 21 GLY GLY A . n A 1 39 THR 39 22 22 THR THR A . n A 1 40 ARG 40 23 23 ARG ARG A . n A 1 41 SER 41 24 24 SER SER A . n A 1 42 ALA 42 25 25 ALA ALA A . n A 1 43 PHE 43 26 26 PHE PHE A . n A 1 44 SER 44 27 27 SER SER A . n A 1 45 ASN 45 28 28 ASN ASN A . n A 1 46 ILE 46 29 29 ILE ILE A . n A 1 47 GLN 47 30 30 GLN GLN A . n A 1 48 ALA 48 31 31 ALA ALA A . n A 1 49 GLU 49 32 32 GLU GLU A . n A 1 50 ASP 50 33 33 ASP ASP A . n A 1 51 TYR 51 34 34 TYR TYR A . n A 1 52 ASP 52 35 35 ASP ASP A . n A 1 53 SER 53 36 36 SER SER A . n A 1 54 SER 54 37 37 SER SER A . n A 1 55 TYR 55 38 38 TYR TYR A . n A 1 56 GLY 56 39 39 GLY GLY A . n A 1 57 PRO 57 40 40 PRO PRO A . n A 1 58 ASN 58 41 41 ASN ASN A . n A 1 59 LEU 59 42 42 LEU LEU A . n A 1 60 GLN 60 43 43 GLN GLN A . n A 1 61 ILE 61 44 44 ILE ILE A . n A 1 62 PHE 62 45 45 PHE PHE A . n A 1 63 SER 63 46 46 SER SER A . n A 1 64 LEU 64 47 47 LEU LEU A . n A 1 65 PRO 65 48 48 PRO PRO A . n A 1 66 GLY 66 49 49 GLY GLY A . n A 1 67 GLY 67 50 50 GLY GLY A . n A 1 68 GLY 68 51 51 GLY GLY A . n A 1 69 SER 69 52 52 SER SER A . n A 1 70 ALA 70 53 53 ALA ALA A . n A 1 71 ILE 71 54 54 ILE ILE A . n A 1 72 GLY 72 55 55 GLY GLY A . n A 1 73 TYR 73 56 56 TYR TYR A . n A 1 74 ILE 74 57 57 ILE ILE A . n A 1 75 GLU 75 58 58 GLU GLU A . n A 1 76 ASN 76 59 59 ASN ASN A . n A 1 77 GLY 77 60 60 GLY GLY A . n A 1 78 TYR 78 61 61 TYR TYR A . n A 1 79 SER 79 62 62 SER SER A . n A 1 80 THR 80 63 63 THR THR A . n A 1 81 THR 81 64 64 THR THR A . n A 1 82 TYR 82 65 65 TYR TYR A . n A 1 83 LYS 83 66 66 LYS LYS A . n A 1 84 ASN 84 67 67 ASN ASN A . n A 1 85 ILE 85 68 68 ILE ILE A . n A 1 86 ASP 86 69 69 ASP ASP A . n A 1 87 PHE 87 70 70 PHE PHE A . n A 1 88 GLY 88 71 71 GLY GLY A . n A 1 89 ASP 89 72 72 ASP ASP A . n A 1 90 GLY 90 73 73 GLY GLY A . n A 1 91 ALA 91 74 74 ALA ALA A . n A 1 92 THR 92 75 75 THR THR A . n A 1 93 SER 93 76 76 SER SER A . n A 1 94 VAL 94 77 77 VAL VAL A . n A 1 95 THR 95 78 78 THR THR A . n A 1 96 ALA 96 79 79 ALA ALA A . n A 1 97 ARG 97 80 80 ARG ARG A . n A 1 98 VAL 98 81 81 VAL VAL A . n A 1 99 ALA 99 82 82 ALA ALA A . n A 1 100 THR 100 83 83 THR THR A . n A 1 101 GLN 101 84 84 GLN GLN A . n A 1 102 ASN 102 85 85 ASN ASN A . n A 1 103 ALA 103 86 86 ALA ALA A . n A 1 104 THR 104 87 87 THR THR A . n A 1 105 THR 105 88 88 THR THR A . n A 1 106 ILE 106 89 89 ILE ILE A . n A 1 107 GLN 107 90 90 GLN GLN A . n A 1 108 VAL 108 91 91 VAL VAL A . n A 1 109 ARG 109 92 92 ARG ARG A . n A 1 110 LEU 110 93 93 LEU LEU A . n A 1 111 GLY 111 94 94 GLY GLY A . n A 1 112 SER 112 95 95 SER SER A . n A 1 113 PRO 113 96 96 PRO PRO A . n A 1 114 SER 114 97 97 SER SER A . n A 1 115 GLY 115 98 98 GLY GLY A . n A 1 116 THR 116 99 99 THR THR A . n A 1 117 LEU 117 100 100 LEU LEU A . n A 1 118 LEU 118 101 101 LEU LEU A . n A 1 119 GLY 119 102 102 GLY GLY A . n A 1 120 THR 120 103 103 THR THR A . n A 1 121 ILE 121 104 104 ILE ILE A . n A 1 122 TYR 122 105 105 TYR TYR A . n A 1 123 VAL 123 106 106 VAL VAL A . n A 1 124 GLY 124 107 107 GLY GLY A . n A 1 125 SER 125 108 108 SER SER A . n A 1 126 THR 126 109 109 THR THR A . n A 1 127 GLY 127 110 110 GLY GLY A . n A 1 128 SER 128 111 111 SER SER A . n A 1 129 PHE 129 112 112 PHE PHE A . n A 1 130 ASP 130 113 113 ASP ASP A . n A 1 131 THR 131 114 114 THR THR A . n A 1 132 TYR 132 115 115 TYR TYR A . n A 1 133 ARG 133 116 116 ARG ARG A . n A 1 134 ASP 134 117 117 ASP ASP A . n A 1 135 VAL 135 118 118 VAL VAL A . n A 1 136 SER 136 119 119 SER SER A . n A 1 137 ALA 137 120 120 ALA ALA A . n A 1 138 THR 138 121 121 THR THR A . n A 1 139 ILE 139 122 122 ILE ILE A . n A 1 140 SER 140 123 123 SER SER A . n A 1 141 ASN 141 124 124 ASN ASN A . n A 1 142 THR 142 125 125 THR THR A . n A 1 143 ALA 143 126 126 ALA ALA A . n A 1 144 GLY 144 127 127 GLY GLY A . n A 1 145 VAL 145 128 128 VAL VAL A . n A 1 146 LYS 146 129 129 LYS LYS A . n A 1 147 ASP 147 130 130 ASP ASP A . n A 1 148 ILE 148 131 131 ILE ILE A . n A 1 149 VAL 149 132 132 VAL VAL A . n A 1 150 LEU 150 133 133 LEU LEU A . n A 1 151 VAL 151 134 134 VAL VAL A . n A 1 152 PHE 152 135 135 PHE PHE A . n A 1 153 SER 153 136 136 SER SER A . n A 1 154 GLY 154 137 137 GLY GLY A . n A 1 155 PRO 155 138 138 PRO PRO A . n A 1 156 VAL 156 139 139 VAL VAL A . n A 1 157 ASN 157 140 140 ASN ASN A . n A 1 158 VAL 158 141 141 VAL VAL A . n A 1 159 ASP 159 142 142 ASP ASP A . n A 1 160 TRP 160 143 143 TRP TRP A . n A 1 161 PHE 161 144 144 PHE PHE A . n A 1 162 VAL 162 145 145 VAL VAL A . n A 1 163 PHE 163 146 146 PHE PHE A . n A 1 164 SER 164 147 147 SER SER A . n A 1 165 LYS 165 148 148 LYS LYS A . n A 1 166 SER 166 149 149 SER SER A . n A 1 167 GLY 167 150 150 GLY GLY A . n A 1 168 THR 168 151 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 ACY 1 1150 1150 ACY ACY A . E 4 CA 1 1153 1153 CA CA A . F 5 HOH 1 2001 2001 HOH HOH A . F 5 HOH 2 2002 2002 HOH HOH A . F 5 HOH 3 2003 2003 HOH HOH A . F 5 HOH 4 2004 2004 HOH HOH A . F 5 HOH 5 2005 2005 HOH HOH A . F 5 HOH 6 2006 2006 HOH HOH A . F 5 HOH 7 2007 2007 HOH HOH A . F 5 HOH 8 2008 2008 HOH HOH A . F 5 HOH 9 2009 2009 HOH HOH A . F 5 HOH 10 2010 2010 HOH HOH A . F 5 HOH 11 2011 2011 HOH HOH A . F 5 HOH 12 2012 2012 HOH HOH A . F 5 HOH 13 2013 2013 HOH HOH A . F 5 HOH 14 2014 2014 HOH HOH A . F 5 HOH 15 2015 2015 HOH HOH A . F 5 HOH 16 2016 2016 HOH HOH A . F 5 HOH 17 2017 2017 HOH HOH A . F 5 HOH 18 2018 2018 HOH HOH A . F 5 HOH 19 2019 2019 HOH HOH A . F 5 HOH 20 2020 2020 HOH HOH A . F 5 HOH 21 2021 2021 HOH HOH A . F 5 HOH 22 2022 2022 HOH HOH A . F 5 HOH 23 2023 2023 HOH HOH A . F 5 HOH 24 2024 2024 HOH HOH A . F 5 HOH 25 2025 2025 HOH HOH A . F 5 HOH 26 2026 2026 HOH HOH A . F 5 HOH 27 2027 2027 HOH HOH A . F 5 HOH 28 2028 2028 HOH HOH A . F 5 HOH 29 2029 2029 HOH HOH A . F 5 HOH 30 2030 2030 HOH HOH A . F 5 HOH 31 2031 2031 HOH HOH A . F 5 HOH 32 2032 2032 HOH HOH A . F 5 HOH 33 2033 2033 HOH HOH A . F 5 HOH 34 2034 2034 HOH HOH A . F 5 HOH 35 2035 2035 HOH HOH A . F 5 HOH 36 2036 2036 HOH HOH A . F 5 HOH 37 2037 2037 HOH HOH A . F 5 HOH 38 2038 2038 HOH HOH A . F 5 HOH 39 2039 2039 HOH HOH A . F 5 HOH 40 2040 2040 HOH HOH A . F 5 HOH 41 2041 2041 HOH HOH A . F 5 HOH 42 2042 2042 HOH HOH A . F 5 HOH 43 2043 2043 HOH HOH A . F 5 HOH 44 2044 2044 HOH HOH A . F 5 HOH 45 2045 2045 HOH HOH A . F 5 HOH 46 2046 2046 HOH HOH A . F 5 HOH 47 2047 2047 HOH HOH A . F 5 HOH 48 2048 2048 HOH HOH A . F 5 HOH 49 2049 2049 HOH HOH A . F 5 HOH 50 2050 2050 HOH HOH A . F 5 HOH 51 2051 2051 HOH HOH A . F 5 HOH 52 2052 2052 HOH HOH A . F 5 HOH 53 2053 2053 HOH HOH A . F 5 HOH 54 2054 2054 HOH HOH A . F 5 HOH 55 2055 2055 HOH HOH A . F 5 HOH 56 2056 2056 HOH HOH A . F 5 HOH 57 2057 2057 HOH HOH A . F 5 HOH 58 2058 2058 HOH HOH A . F 5 HOH 59 2059 2059 HOH HOH A . F 5 HOH 60 2060 2060 HOH HOH A . F 5 HOH 61 2061 2061 HOH HOH A . F 5 HOH 62 2062 2062 HOH HOH A . F 5 HOH 63 2063 2063 HOH HOH A . F 5 HOH 64 2064 2064 HOH HOH A . F 5 HOH 65 2065 2065 HOH HOH A . F 5 HOH 66 2066 2066 HOH HOH A . F 5 HOH 67 2067 2067 HOH HOH A . F 5 HOH 68 2068 2068 HOH HOH A . F 5 HOH 69 2069 2069 HOH HOH A . F 5 HOH 70 2070 2070 HOH HOH A . F 5 HOH 71 2071 2071 HOH HOH A . F 5 HOH 72 2072 2072 HOH HOH A . F 5 HOH 73 2073 2073 HOH HOH A . F 5 HOH 74 2074 2074 HOH HOH A . F 5 HOH 75 2075 2075 HOH HOH A . F 5 HOH 76 2076 2076 HOH HOH A . F 5 HOH 77 2077 2077 HOH HOH A . F 5 HOH 78 2078 2078 HOH HOH A . F 5 HOH 79 2079 2079 HOH HOH A . F 5 HOH 80 2080 2080 HOH HOH A . F 5 HOH 81 2081 2081 HOH HOH A . F 5 HOH 82 2082 2082 HOH HOH A . F 5 HOH 83 2083 2083 HOH HOH A . F 5 HOH 84 2084 2084 HOH HOH A . F 5 HOH 85 2085 2085 HOH HOH A . F 5 HOH 86 2086 2086 HOH HOH A . F 5 HOH 87 2087 2087 HOH HOH A . F 5 HOH 88 2088 2088 HOH HOH A . F 5 HOH 89 2089 2089 HOH HOH A . F 5 HOH 90 2090 2090 HOH HOH A . F 5 HOH 91 2091 2091 HOH HOH A . F 5 HOH 92 2092 2092 HOH HOH A . F 5 HOH 93 2093 2093 HOH HOH A . F 5 HOH 94 2094 2094 HOH HOH A . F 5 HOH 95 2095 2095 HOH HOH A . F 5 HOH 96 2096 2096 HOH HOH A . F 5 HOH 97 2097 2097 HOH HOH A . F 5 HOH 98 2098 2098 HOH HOH A . F 5 HOH 99 2099 2099 HOH HOH A . F 5 HOH 100 2100 2100 HOH HOH A . F 5 HOH 101 2101 2101 HOH HOH A . F 5 HOH 102 2102 2102 HOH HOH A . F 5 HOH 103 2103 2103 HOH HOH A . F 5 HOH 104 2104 2104 HOH HOH A . F 5 HOH 105 2105 2105 HOH HOH A . F 5 HOH 106 2106 2106 HOH HOH A . F 5 HOH 107 2107 2107 HOH HOH A . F 5 HOH 108 2108 2108 HOH HOH A . F 5 HOH 109 2109 2109 HOH HOH A . F 5 HOH 110 2110 2110 HOH HOH A . F 5 HOH 111 2111 2111 HOH HOH A . F 5 HOH 112 2112 2112 HOH HOH A . F 5 HOH 113 2113 2113 HOH HOH A . F 5 HOH 114 2114 2114 HOH HOH A . F 5 HOH 115 2115 2115 HOH HOH A . F 5 HOH 116 2116 2116 HOH HOH A . F 5 HOH 117 2117 2117 HOH HOH A . F 5 HOH 118 2118 2118 HOH HOH A . F 5 HOH 119 2119 2119 HOH HOH A . F 5 HOH 120 2120 2120 HOH HOH A . F 5 HOH 121 2121 2121 HOH HOH A . F 5 HOH 122 2122 2122 HOH HOH A . F 5 HOH 123 2123 2123 HOH HOH A . F 5 HOH 124 2124 2124 HOH HOH A . F 5 HOH 125 2125 2125 HOH HOH A . F 5 HOH 126 2126 2126 HOH HOH A . F 5 HOH 127 2127 2127 HOH HOH A . F 5 HOH 128 2128 2128 HOH HOH A . F 5 HOH 129 2129 2129 HOH HOH A . F 5 HOH 130 2130 2130 HOH HOH A . F 5 HOH 131 2131 2131 HOH HOH A . F 5 HOH 132 2132 2132 HOH HOH A . F 5 HOH 133 2133 2133 HOH HOH A . F 5 HOH 134 2134 2134 HOH HOH A . F 5 HOH 135 2135 2135 HOH HOH A . F 5 HOH 136 2136 2136 HOH HOH A . F 5 HOH 137 2137 2137 HOH HOH A . F 5 HOH 138 2138 2138 HOH HOH A . F 5 HOH 139 2139 2139 HOH HOH A . F 5 HOH 140 2140 2140 HOH HOH A . F 5 HOH 141 2141 2141 HOH HOH A . F 5 HOH 142 2142 2142 HOH HOH A . F 5 HOH 143 2143 2143 HOH HOH A . F 5 HOH 144 2144 2144 HOH HOH A . F 5 HOH 145 2145 2145 HOH HOH A . F 5 HOH 146 2146 2146 HOH HOH A . F 5 HOH 147 2147 2147 HOH HOH A . F 5 HOH 148 2148 2148 HOH HOH A . F 5 HOH 149 2149 2149 HOH HOH A . F 5 HOH 150 2150 2150 HOH HOH A . F 5 HOH 151 2151 2151 HOH HOH A . F 5 HOH 152 2152 2152 HOH HOH A . F 5 HOH 153 2153 2153 HOH HOH A . F 5 HOH 154 2154 2154 HOH HOH A . F 5 HOH 155 2155 2155 HOH HOH A . F 5 HOH 156 2156 2156 HOH HOH A . F 5 HOH 157 2157 2157 HOH HOH A . F 5 HOH 158 2158 2158 HOH HOH A . F 5 HOH 159 2159 2159 HOH HOH A . F 5 HOH 160 2160 2160 HOH HOH A . F 5 HOH 161 2161 2161 HOH HOH A . F 5 HOH 162 2162 2162 HOH HOH A . F 5 HOH 163 2163 2163 HOH HOH A . F 5 HOH 164 2164 2164 HOH HOH A . F 5 HOH 165 2165 2165 HOH HOH A . F 5 HOH 166 2166 2166 HOH HOH A . F 5 HOH 167 2167 2167 HOH HOH A . F 5 HOH 168 2168 2168 HOH HOH A . F 5 HOH 169 2169 2169 HOH HOH A . F 5 HOH 170 2170 2170 HOH HOH A . F 5 HOH 171 2171 2171 HOH HOH A . F 5 HOH 172 2172 2172 HOH HOH A . F 5 HOH 173 2173 2173 HOH HOH A . F 5 HOH 174 2174 2174 HOH HOH A . F 5 HOH 175 2175 2175 HOH HOH A . F 5 HOH 176 2176 2176 HOH HOH A . F 5 HOH 177 2177 2177 HOH HOH A . F 5 HOH 178 2178 2178 HOH HOH A . F 5 HOH 179 2179 2179 HOH HOH A . F 5 HOH 180 2180 2180 HOH HOH A . F 5 HOH 181 2181 2181 HOH HOH A . F 5 HOH 182 2182 2182 HOH HOH A . F 5 HOH 183 2183 2183 HOH HOH A . F 5 HOH 184 2184 2184 HOH HOH A . F 5 HOH 185 2185 2185 HOH HOH A . F 5 HOH 186 2186 2186 HOH HOH A . F 5 HOH 187 2187 2187 HOH HOH A . F 5 HOH 188 2188 2188 HOH HOH A . F 5 HOH 189 2189 2189 HOH HOH A . F 5 HOH 190 2190 2190 HOH HOH A . F 5 HOH 191 2191 2191 HOH HOH A . F 5 HOH 192 2192 2192 HOH HOH A . F 5 HOH 193 2193 2193 HOH HOH A . F 5 HOH 194 2194 2194 HOH HOH A . F 5 HOH 195 2195 2195 HOH HOH A . F 5 HOH 196 2196 2196 HOH HOH A . F 5 HOH 197 2197 2197 HOH HOH A . F 5 HOH 198 2198 2198 HOH HOH A . F 5 HOH 199 2199 2199 HOH HOH A . F 5 HOH 200 2200 2200 HOH HOH A . F 5 HOH 201 2201 2201 HOH HOH A . F 5 HOH 202 2202 2202 HOH HOH A . F 5 HOH 203 2203 2203 HOH HOH A . F 5 HOH 204 2204 2204 HOH HOH A . F 5 HOH 205 2205 2205 HOH HOH A . F 5 HOH 206 2206 2206 HOH HOH A . F 5 HOH 207 2207 2207 HOH HOH A . F 5 HOH 208 2208 2208 HOH HOH A . F 5 HOH 209 2209 2209 HOH HOH A . F 5 HOH 210 2210 2210 HOH HOH A . F 5 HOH 211 2211 2211 HOH HOH A . F 5 HOH 212 2212 2212 HOH HOH A . F 5 HOH 213 2213 2213 HOH HOH A . F 5 HOH 214 2214 2214 HOH HOH A . F 5 HOH 215 2215 2215 HOH HOH A . F 5 HOH 216 2216 2216 HOH HOH A . F 5 HOH 217 2217 2217 HOH HOH A . F 5 HOH 218 2218 2218 HOH HOH A . F 5 HOH 219 2219 2219 HOH HOH A . F 5 HOH 220 2220 2220 HOH HOH A . F 5 HOH 221 2221 2221 HOH HOH A . F 5 HOH 222 2222 2222 HOH HOH A . F 5 HOH 223 2223 2223 HOH HOH A . F 5 HOH 224 2224 2224 HOH HOH A . F 5 HOH 225 2225 2225 HOH HOH A . F 5 HOH 226 2226 2226 HOH HOH A . F 5 HOH 227 2227 2227 HOH HOH A . F 5 HOH 228 2228 2228 HOH HOH A . F 5 HOH 229 2229 2229 HOH HOH A . F 5 HOH 230 2230 2230 HOH HOH A . F 5 HOH 231 2231 2231 HOH HOH A . F 5 HOH 232 2232 2232 HOH HOH A . F 5 HOH 233 2233 2233 HOH HOH A . F 5 HOH 234 2234 2234 HOH HOH A . F 5 HOH 235 2235 2235 HOH HOH A . F 5 HOH 236 2236 2236 HOH HOH A . F 5 HOH 237 2237 2237 HOH HOH A . F 5 HOH 238 2238 2238 HOH HOH A . F 5 HOH 239 2239 2239 HOH HOH A . F 5 HOH 240 2240 2240 HOH HOH A . F 5 HOH 241 2241 2241 HOH HOH A . F 5 HOH 242 2242 2242 HOH HOH A . F 5 HOH 243 2243 2243 HOH HOH A . F 5 HOH 244 2244 2244 HOH HOH A . F 5 HOH 245 2245 2245 HOH HOH A . F 5 HOH 246 2246 2246 HOH HOH A . F 5 HOH 247 2247 2247 HOH HOH A . F 5 HOH 248 2248 2248 HOH HOH A . F 5 HOH 249 2249 2249 HOH HOH A . F 5 HOH 250 2250 2250 HOH HOH A . F 5 HOH 251 2251 2251 HOH HOH A . F 5 HOH 252 2252 2252 HOH HOH A . F 5 HOH 253 2253 2253 HOH HOH A . F 5 HOH 254 2254 2254 HOH HOH A . F 5 HOH 255 2255 2255 HOH HOH A . F 5 HOH 256 2256 2256 HOH HOH A . F 5 HOH 257 2257 2257 HOH HOH A . F 5 HOH 258 2258 2258 HOH HOH A . F 5 HOH 259 2259 2259 HOH HOH A . F 5 HOH 260 2260 2260 HOH HOH A . F 5 HOH 261 2261 2261 HOH HOH A . F 5 HOH 262 2262 2262 HOH HOH A . F 5 HOH 263 2263 2263 HOH HOH A . F 5 HOH 264 2264 2264 HOH HOH A . F 5 HOH 265 2265 2265 HOH HOH A . F 5 HOH 266 2266 2266 HOH HOH A . F 5 HOH 267 2267 2267 HOH HOH A . F 5 HOH 268 2268 2268 HOH HOH A . F 5 HOH 269 2269 2269 HOH HOH A . F 5 HOH 270 2270 2270 HOH HOH A . F 5 HOH 271 2271 2271 HOH HOH A . F 5 HOH 272 2272 2272 HOH HOH A . F 5 HOH 273 2273 2273 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_900024 _pdbx_molecule_features.name beta-laminaribiose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Antimicrobial _pdbx_molecule_features.details oligosaccharide # loop_ _pdbx_molecule.instance_id _pdbx_molecule.prd_id _pdbx_molecule.asym_id 1 PRD_900024 B 2 PRD_900024 C # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLN 47 ? A GLN 30 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? A SER 69 ? A SER 52 ? 1_555 162.5 ? 2 OE1 ? A GLN 47 ? A GLN 30 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 OD1 ? A ASP 159 ? A ASP 142 ? 1_555 91.9 ? 3 O ? A SER 69 ? A SER 52 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 OD1 ? A ASP 159 ? A ASP 142 ? 1_555 83.8 ? 4 OE1 ? A GLN 47 ? A GLN 30 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? A ASP 159 ? A ASP 142 ? 1_555 86.2 ? 5 O ? A SER 69 ? A SER 52 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? A ASP 159 ? A ASP 142 ? 1_555 109.1 ? 6 OD1 ? A ASP 159 ? A ASP 142 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? A ASP 159 ? A ASP 142 ? 1_555 76.8 ? 7 OE1 ? A GLN 47 ? A GLN 30 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? F HOH . ? A HOH 2035 ? 1_555 76.2 ? 8 O ? A SER 69 ? A SER 52 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? F HOH . ? A HOH 2035 ? 1_555 86.3 ? 9 OD1 ? A ASP 159 ? A ASP 142 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? F HOH . ? A HOH 2035 ? 1_555 76.5 ? 10 O ? A ASP 159 ? A ASP 142 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? F HOH . ? A HOH 2035 ? 1_555 147.3 ? 11 OE1 ? A GLN 47 ? A GLN 30 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? F HOH . ? A HOH 2040 ? 1_555 79.3 ? 12 O ? A SER 69 ? A SER 52 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? F HOH . ? A HOH 2040 ? 1_555 86.0 ? 13 OD1 ? A ASP 159 ? A ASP 142 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? F HOH . ? A HOH 2040 ? 1_555 108.8 ? 14 O ? A ASP 159 ? A ASP 142 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? F HOH . ? A HOH 2040 ? 1_555 164.5 ? 15 O ? F HOH . ? A HOH 2035 ? 1_555 CA ? E CA . ? A CA 1153 ? 1_555 O ? F HOH . ? A HOH 2040 ? 1_555 32.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-03-13 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 5 'Structure model' 2 1 2023-12-13 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other 8 4 'Structure model' 'Structure summary' 9 5 'Structure model' 'Data collection' 10 5 'Structure model' 'Database references' 11 5 'Structure model' 'Refinement description' 12 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' atom_site_anisotrop 3 4 'Structure model' chem_comp 4 4 'Structure model' entity 5 4 'Structure model' entity_name_com 6 4 'Structure model' pdbx_branch_scheme 7 4 'Structure model' pdbx_chem_comp_identifier 8 4 'Structure model' pdbx_database_status 9 4 'Structure model' pdbx_entity_branch 10 4 'Structure model' pdbx_entity_branch_descriptor 11 4 'Structure model' pdbx_entity_branch_link 12 4 'Structure model' pdbx_entity_branch_list 13 4 'Structure model' pdbx_entity_nonpoly 14 4 'Structure model' pdbx_molecule_features 15 4 'Structure model' pdbx_nonpoly_scheme 16 4 'Structure model' pdbx_struct_assembly_gen 17 4 'Structure model' pdbx_struct_conn_angle 18 4 'Structure model' pdbx_validate_close_contact 19 4 'Structure model' struct_asym 20 4 'Structure model' struct_conn 21 4 'Structure model' struct_site 22 4 'Structure model' struct_site_gen 23 5 'Structure model' chem_comp 24 5 'Structure model' chem_comp_atom 25 5 'Structure model' chem_comp_bond 26 5 'Structure model' database_2 27 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_atom_site.auth_asym_id' 6 4 'Structure model' '_atom_site.auth_atom_id' 7 4 'Structure model' '_atom_site.auth_comp_id' 8 4 'Structure model' '_atom_site.auth_seq_id' 9 4 'Structure model' '_atom_site.label_asym_id' 10 4 'Structure model' '_atom_site.label_atom_id' 11 4 'Structure model' '_atom_site.label_comp_id' 12 4 'Structure model' '_atom_site.label_entity_id' 13 4 'Structure model' '_atom_site.occupancy' 14 4 'Structure model' '_atom_site.type_symbol' 15 4 'Structure model' '_atom_site_anisotrop.U[1][1]' 16 4 'Structure model' '_atom_site_anisotrop.U[1][2]' 17 4 'Structure model' '_atom_site_anisotrop.U[1][3]' 18 4 'Structure model' '_atom_site_anisotrop.U[2][2]' 19 4 'Structure model' '_atom_site_anisotrop.U[2][3]' 20 4 'Structure model' '_atom_site_anisotrop.U[3][3]' 21 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_asym_id' 22 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 23 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_comp_id' 24 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id' 25 4 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id' 26 4 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 27 4 'Structure model' '_atom_site_anisotrop.pdbx_label_comp_id' 28 4 'Structure model' '_atom_site_anisotrop.type_symbol' 29 4 'Structure model' '_chem_comp.name' 30 4 'Structure model' '_chem_comp.type' 31 4 'Structure model' '_entity.formula_weight' 32 4 'Structure model' '_entity.pdbx_description' 33 4 'Structure model' '_entity.pdbx_number_of_molecules' 34 4 'Structure model' '_entity.src_method' 35 4 'Structure model' '_entity.type' 36 4 'Structure model' '_pdbx_database_status.status_code_sf' 37 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 38 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 39 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 40 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 41 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 42 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 43 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 44 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 45 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 46 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 47 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 48 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 49 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 50 4 'Structure model' '_pdbx_struct_conn_angle.value' 51 4 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_1' 52 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1' 53 4 'Structure model' '_struct_conn.conn_type_id' 54 4 'Structure model' '_struct_conn.id' 55 4 'Structure model' '_struct_conn.pdbx_dist_value' 56 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 57 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 58 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 59 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 60 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 61 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 62 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 63 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 64 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 65 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 66 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 67 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 68 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 69 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 70 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 71 5 'Structure model' '_chem_comp.pdbx_synonyms' 72 5 'Structure model' '_database_2.pdbx_DOI' 73 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.24 ? 1 MOSFLM 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 AMoRE phasing . ? 4 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ; SHEET THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW, TWO SHEETS ARE DEFINED. ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OH A TYR 105 ? B O A HOH 2187 ? ? 1.46 2 1 O2 C BGC 1 ? ? O A HOH 2266 ? ? 1.66 3 1 CZ A TYR 105 ? B O A HOH 2186 ? ? 1.81 4 1 O A HOH 2006 ? ? O A HOH 2127 ? ? 1.99 5 1 OH A TYR 56 ? B O A HOH 2104 ? ? 2.03 6 1 O A GLY 20 ? ? O A HOH 2002 ? ? 2.06 7 1 NZ A LYS 66 ? ? O A HOH 2126 ? ? 2.08 8 1 O A HOH 2143 ? ? O A HOH 2145 ? ? 2.16 9 1 CE2 A TYR 105 ? B O A HOH 2186 ? ? 2.16 10 1 OG A SER 149 ? ? O A HOH 2248 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 CE1 A TYR 105 ? B 1_555 O A HOH 2079 ? ? 3_555 1.16 2 1 CD1 A TYR 105 ? B 1_555 O A HOH 2079 ? ? 3_555 1.77 3 1 O A HOH 2018 ? ? 1_555 O A HOH 2116 ? ? 2_564 1.88 4 1 O A HOH 2076 ? ? 1_555 O A HOH 2214 ? ? 3_545 1.98 5 1 O A HOH 2090 ? ? 1_555 O A HOH 2142 ? ? 1_455 2.13 6 1 O A HOH 2208 ? ? 1_555 O A HOH 2250 ? ? 4_465 2.15 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A TYR 105 ? ? CG A TYR 105 ? A 1.635 1.512 0.123 0.015 N 2 1 CB A SER 136 ? ? OG A SER 136 ? A 1.291 1.418 -0.127 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A GLN 43 ? ? CB A GLN 43 ? ? CG A GLN 43 ? A 128.20 113.40 14.80 2.20 N 2 1 NE A ARG 92 ? A CZ A ARG 92 ? A NH1 A ARG 92 ? A 125.96 120.30 5.66 0.50 N 3 1 NE A ARG 92 ? A CZ A ARG 92 ? A NH2 A ARG 92 ? A 115.83 120.30 -4.47 0.50 N 4 1 CB A TYR 105 ? ? CG A TYR 105 ? B CD2 A TYR 105 ? B 112.15 121.00 -8.85 0.60 N 5 1 CB A TYR 105 ? ? CG A TYR 105 ? B CD1 A TYR 105 ? B 129.90 121.00 8.90 0.60 N 6 1 NE A ARG 116 ? ? CZ A ARG 116 ? ? NH2 A ARG 116 ? ? 117.30 120.30 -3.00 0.50 N 7 1 CA A VAL 118 ? ? CB A VAL 118 ? ? CG1 A VAL 118 ? B 120.75 110.90 9.85 1.50 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 33 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -93.00 _pdbx_validate_torsion.psi 42.45 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2135 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.28 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLY 150 ? CA ? A GLY 167 CA 2 1 Y 1 A GLY 150 ? C ? A GLY 167 C 3 1 Y 1 A GLY 150 ? O ? A GLY 167 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -16 ? A MET 1 2 1 Y 1 A GLY -15 ? A GLY 2 3 1 Y 1 A SER -14 ? A SER 3 4 1 Y 1 A SER -13 ? A SER 4 5 1 Y 1 A HIS -12 ? A HIS 5 6 1 Y 1 A HIS -11 ? A HIS 6 7 1 Y 1 A HIS -10 ? A HIS 7 8 1 Y 1 A HIS -9 ? A HIS 8 9 1 Y 1 A HIS -8 ? A HIS 9 10 1 Y 1 A HIS -7 ? A HIS 10 11 1 Y 1 A SER -6 ? A SER 11 12 1 Y 1 A SER -5 ? A SER 12 13 1 Y 1 A GLY -4 ? A GLY 13 14 1 Y 1 A LEU -3 ? A LEU 14 15 1 Y 1 A VAL -2 ? A VAL 15 16 1 Y 1 A PRO -1 ? A PRO 16 17 1 Y 1 A ARG 0 ? A ARG 17 18 1 Y 1 A GLY 1 ? A GLY 18 19 1 Y 1 A SER 2 ? A SER 19 20 1 Y 1 A HIS 3 ? A HIS 20 21 1 Y 1 A MET 4 ? A MET 21 22 1 Y 1 A ALA 5 ? A ALA 22 23 1 Y 1 A SER 6 ? A SER 23 24 1 Y 1 A THR 7 ? A THR 24 25 1 Y 1 A PRO 8 ? A PRO 25 26 1 Y 1 A ALA 9 ? A ALA 26 27 1 Y 1 A ASN 10 ? A ASN 27 28 1 Y 1 A VAL 11 ? A VAL 28 29 1 Y 1 A ASN 12 ? A ASN 29 30 1 Y 1 A SER 13 ? A SER 30 31 1 Y 1 A GLY 14 ? A GLY 31 32 1 Y 1 A PRO 15 ? A PRO 32 33 1 Y 1 A THR 16 ? A THR 33 34 1 Y 1 A SER 17 ? A SER 34 35 1 Y 1 A PRO 18 ? A PRO 35 36 1 Y 1 A THR 151 ? A THR 168 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACY C C N N 1 ACY O O N N 2 ACY OXT O N N 3 ACY CH3 C N N 4 ACY HXT H N N 5 ACY H1 H N N 6 ACY H2 H N N 7 ACY H3 H N N 8 ALA N N N N 9 ALA CA C N S 10 ALA C C N N 11 ALA O O N N 12 ALA CB C N N 13 ALA OXT O N N 14 ALA H H N N 15 ALA H2 H N N 16 ALA HA H N N 17 ALA HB1 H N N 18 ALA HB2 H N N 19 ALA HB3 H N N 20 ALA HXT H N N 21 ARG N N N N 22 ARG CA C N S 23 ARG C C N N 24 ARG O O N N 25 ARG CB C N N 26 ARG CG C N N 27 ARG CD C N N 28 ARG NE N N N 29 ARG CZ C N N 30 ARG NH1 N N N 31 ARG NH2 N N N 32 ARG OXT O N N 33 ARG H H N N 34 ARG H2 H N N 35 ARG HA H N N 36 ARG HB2 H N N 37 ARG HB3 H N N 38 ARG HG2 H N N 39 ARG HG3 H N N 40 ARG HD2 H N N 41 ARG HD3 H N N 42 ARG HE H N N 43 ARG HH11 H N N 44 ARG HH12 H N N 45 ARG HH21 H N N 46 ARG HH22 H N N 47 ARG HXT H N N 48 ASN N N N N 49 ASN CA C N S 50 ASN C C N N 51 ASN O O N N 52 ASN CB C N N 53 ASN CG C N N 54 ASN OD1 O N N 55 ASN ND2 N N N 56 ASN OXT O N N 57 ASN H H N N 58 ASN H2 H N N 59 ASN HA H N N 60 ASN HB2 H N N 61 ASN HB3 H N N 62 ASN HD21 H N N 63 ASN HD22 H N N 64 ASN HXT H N N 65 ASP N N N N 66 ASP CA C N S 67 ASP C C N N 68 ASP O O N N 69 ASP CB C N N 70 ASP CG C N N 71 ASP OD1 O N N 72 ASP OD2 O N N 73 ASP OXT O N N 74 ASP H H N N 75 ASP H2 H N N 76 ASP HA H N N 77 ASP HB2 H N N 78 ASP HB3 H N N 79 ASP HD2 H N N 80 ASP HXT H N N 81 BGC C2 C N R 82 BGC C3 C N S 83 BGC C4 C N S 84 BGC C5 C N R 85 BGC C6 C N N 86 BGC C1 C N R 87 BGC O1 O N N 88 BGC O2 O N N 89 BGC O3 O N N 90 BGC O4 O N N 91 BGC O5 O N N 92 BGC O6 O N N 93 BGC H2 H N N 94 BGC H3 H N N 95 BGC H4 H N N 96 BGC H5 H N N 97 BGC H61 H N N 98 BGC H62 H N N 99 BGC H1 H N N 100 BGC HO1 H N N 101 BGC HO2 H N N 102 BGC HO3 H N N 103 BGC HO4 H N N 104 BGC HO6 H N N 105 CA CA CA N N 106 GLN N N N N 107 GLN CA C N S 108 GLN C C N N 109 GLN O O N N 110 GLN CB C N N 111 GLN CG C N N 112 GLN CD C N N 113 GLN OE1 O N N 114 GLN NE2 N N N 115 GLN OXT O N N 116 GLN H H N N 117 GLN H2 H N N 118 GLN HA H N N 119 GLN HB2 H N N 120 GLN HB3 H N N 121 GLN HG2 H N N 122 GLN HG3 H N N 123 GLN HE21 H N N 124 GLN HE22 H N N 125 GLN HXT H N N 126 GLU N N N N 127 GLU CA C N S 128 GLU C C N N 129 GLU O O N N 130 GLU CB C N N 131 GLU CG C N N 132 GLU CD C N N 133 GLU OE1 O N N 134 GLU OE2 O N N 135 GLU OXT O N N 136 GLU H H N N 137 GLU H2 H N N 138 GLU HA H N N 139 GLU HB2 H N N 140 GLU HB3 H N N 141 GLU HG2 H N N 142 GLU HG3 H N N 143 GLU HE2 H N N 144 GLU HXT H N N 145 GLY N N N N 146 GLY CA C N N 147 GLY C C N N 148 GLY O O N N 149 GLY OXT O N N 150 GLY H H N N 151 GLY H2 H N N 152 GLY HA2 H N N 153 GLY HA3 H N N 154 GLY HXT H N N 155 HIS N N N N 156 HIS CA C N S 157 HIS C C N N 158 HIS O O N N 159 HIS CB C N N 160 HIS CG C Y N 161 HIS ND1 N Y N 162 HIS CD2 C Y N 163 HIS CE1 C Y N 164 HIS NE2 N Y N 165 HIS OXT O N N 166 HIS H H N N 167 HIS H2 H N N 168 HIS HA H N N 169 HIS HB2 H N N 170 HIS HB3 H N N 171 HIS HD1 H N N 172 HIS HD2 H N N 173 HIS HE1 H N N 174 HIS HE2 H N N 175 HIS HXT H N N 176 HOH O O N N 177 HOH H1 H N N 178 HOH H2 H N N 179 ILE N N N N 180 ILE CA C N S 181 ILE C C N N 182 ILE O O N N 183 ILE CB C N S 184 ILE CG1 C N N 185 ILE CG2 C N N 186 ILE CD1 C N N 187 ILE OXT O N N 188 ILE H H N N 189 ILE H2 H N N 190 ILE HA H N N 191 ILE HB H N N 192 ILE HG12 H N N 193 ILE HG13 H N N 194 ILE HG21 H N N 195 ILE HG22 H N N 196 ILE HG23 H N N 197 ILE HD11 H N N 198 ILE HD12 H N N 199 ILE HD13 H N N 200 ILE HXT H N N 201 LEU N N N N 202 LEU CA C N S 203 LEU C C N N 204 LEU O O N N 205 LEU CB C N N 206 LEU CG C N N 207 LEU CD1 C N N 208 LEU CD2 C N N 209 LEU OXT O N N 210 LEU H H N N 211 LEU H2 H N N 212 LEU HA H N N 213 LEU HB2 H N N 214 LEU HB3 H N N 215 LEU HG H N N 216 LEU HD11 H N N 217 LEU HD12 H N N 218 LEU HD13 H N N 219 LEU HD21 H N N 220 LEU HD22 H N N 221 LEU HD23 H N N 222 LEU HXT H N N 223 LYS N N N N 224 LYS CA C N S 225 LYS C C N N 226 LYS O O N N 227 LYS CB C N N 228 LYS CG C N N 229 LYS CD C N N 230 LYS CE C N N 231 LYS NZ N N N 232 LYS OXT O N N 233 LYS H H N N 234 LYS H2 H N N 235 LYS HA H N N 236 LYS HB2 H N N 237 LYS HB3 H N N 238 LYS HG2 H N N 239 LYS HG3 H N N 240 LYS HD2 H N N 241 LYS HD3 H N N 242 LYS HE2 H N N 243 LYS HE3 H N N 244 LYS HZ1 H N N 245 LYS HZ2 H N N 246 LYS HZ3 H N N 247 LYS HXT H N N 248 MET N N N N 249 MET CA C N S 250 MET C C N N 251 MET O O N N 252 MET CB C N N 253 MET CG C N N 254 MET SD S N N 255 MET CE C N N 256 MET OXT O N N 257 MET H H N N 258 MET H2 H N N 259 MET HA H N N 260 MET HB2 H N N 261 MET HB3 H N N 262 MET HG2 H N N 263 MET HG3 H N N 264 MET HE1 H N N 265 MET HE2 H N N 266 MET HE3 H N N 267 MET HXT H N N 268 PHE N N N N 269 PHE CA C N S 270 PHE C C N N 271 PHE O O N N 272 PHE CB C N N 273 PHE CG C Y N 274 PHE CD1 C Y N 275 PHE CD2 C Y N 276 PHE CE1 C Y N 277 PHE CE2 C Y N 278 PHE CZ C Y N 279 PHE OXT O N N 280 PHE H H N N 281 PHE H2 H N N 282 PHE HA H N N 283 PHE HB2 H N N 284 PHE HB3 H N N 285 PHE HD1 H N N 286 PHE HD2 H N N 287 PHE HE1 H N N 288 PHE HE2 H N N 289 PHE HZ H N N 290 PHE HXT H N N 291 PRO N N N N 292 PRO CA C N S 293 PRO C C N N 294 PRO O O N N 295 PRO CB C N N 296 PRO CG C N N 297 PRO CD C N N 298 PRO OXT O N N 299 PRO H H N N 300 PRO HA H N N 301 PRO HB2 H N N 302 PRO HB3 H N N 303 PRO HG2 H N N 304 PRO HG3 H N N 305 PRO HD2 H N N 306 PRO HD3 H N N 307 PRO HXT H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACY C O doub N N 1 ACY C OXT sing N N 2 ACY C CH3 sing N N 3 ACY OXT HXT sing N N 4 ACY CH3 H1 sing N N 5 ACY CH3 H2 sing N N 6 ACY CH3 H3 sing N N 7 ALA N CA sing N N 8 ALA N H sing N N 9 ALA N H2 sing N N 10 ALA CA C sing N N 11 ALA CA CB sing N N 12 ALA CA HA sing N N 13 ALA C O doub N N 14 ALA C OXT sing N N 15 ALA CB HB1 sing N N 16 ALA CB HB2 sing N N 17 ALA CB HB3 sing N N 18 ALA OXT HXT sing N N 19 ARG N CA sing N N 20 ARG N H sing N N 21 ARG N H2 sing N N 22 ARG CA C sing N N 23 ARG CA CB sing N N 24 ARG CA HA sing N N 25 ARG C O doub N N 26 ARG C OXT sing N N 27 ARG CB CG sing N N 28 ARG CB HB2 sing N N 29 ARG CB HB3 sing N N 30 ARG CG CD sing N N 31 ARG CG HG2 sing N N 32 ARG CG HG3 sing N N 33 ARG CD NE sing N N 34 ARG CD HD2 sing N N 35 ARG CD HD3 sing N N 36 ARG NE CZ sing N N 37 ARG NE HE sing N N 38 ARG CZ NH1 sing N N 39 ARG CZ NH2 doub N N 40 ARG NH1 HH11 sing N N 41 ARG NH1 HH12 sing N N 42 ARG NH2 HH21 sing N N 43 ARG NH2 HH22 sing N N 44 ARG OXT HXT sing N N 45 ASN N CA sing N N 46 ASN N H sing N N 47 ASN N H2 sing N N 48 ASN CA C sing N N 49 ASN CA CB sing N N 50 ASN CA HA sing N N 51 ASN C O doub N N 52 ASN C OXT sing N N 53 ASN CB CG sing N N 54 ASN CB HB2 sing N N 55 ASN CB HB3 sing N N 56 ASN CG OD1 doub N N 57 ASN CG ND2 sing N N 58 ASN ND2 HD21 sing N N 59 ASN ND2 HD22 sing N N 60 ASN OXT HXT sing N N 61 ASP N CA sing N N 62 ASP N H sing N N 63 ASP N H2 sing N N 64 ASP CA C sing N N 65 ASP CA CB sing N N 66 ASP CA HA sing N N 67 ASP C O doub N N 68 ASP C OXT sing N N 69 ASP CB CG sing N N 70 ASP CB HB2 sing N N 71 ASP CB HB3 sing N N 72 ASP CG OD1 doub N N 73 ASP CG OD2 sing N N 74 ASP OD2 HD2 sing N N 75 ASP OXT HXT sing N N 76 BGC C2 C3 sing N N 77 BGC C2 C1 sing N N 78 BGC C2 O2 sing N N 79 BGC C2 H2 sing N N 80 BGC C3 C4 sing N N 81 BGC C3 O3 sing N N 82 BGC C3 H3 sing N N 83 BGC C4 C5 sing N N 84 BGC C4 O4 sing N N 85 BGC C4 H4 sing N N 86 BGC C5 C6 sing N N 87 BGC C5 O5 sing N N 88 BGC C5 H5 sing N N 89 BGC C6 O6 sing N N 90 BGC C6 H61 sing N N 91 BGC C6 H62 sing N N 92 BGC C1 O1 sing N N 93 BGC C1 O5 sing N N 94 BGC C1 H1 sing N N 95 BGC O1 HO1 sing N N 96 BGC O2 HO2 sing N N 97 BGC O3 HO3 sing N N 98 BGC O4 HO4 sing N N 99 BGC O6 HO6 sing N N 100 GLN N CA sing N N 101 GLN N H sing N N 102 GLN N H2 sing N N 103 GLN CA C sing N N 104 GLN CA CB sing N N 105 GLN CA HA sing N N 106 GLN C O doub N N 107 GLN C OXT sing N N 108 GLN CB CG sing N N 109 GLN CB HB2 sing N N 110 GLN CB HB3 sing N N 111 GLN CG CD sing N N 112 GLN CG HG2 sing N N 113 GLN CG HG3 sing N N 114 GLN CD OE1 doub N N 115 GLN CD NE2 sing N N 116 GLN NE2 HE21 sing N N 117 GLN NE2 HE22 sing N N 118 GLN OXT HXT sing N N 119 GLU N CA sing N N 120 GLU N H sing N N 121 GLU N H2 sing N N 122 GLU CA C sing N N 123 GLU CA CB sing N N 124 GLU CA HA sing N N 125 GLU C O doub N N 126 GLU C OXT sing N N 127 GLU CB CG sing N N 128 GLU CB HB2 sing N N 129 GLU CB HB3 sing N N 130 GLU CG CD sing N N 131 GLU CG HG2 sing N N 132 GLU CG HG3 sing N N 133 GLU CD OE1 doub N N 134 GLU CD OE2 sing N N 135 GLU OE2 HE2 sing N N 136 GLU OXT HXT sing N N 137 GLY N CA sing N N 138 GLY N H sing N N 139 GLY N H2 sing N N 140 GLY CA C sing N N 141 GLY CA HA2 sing N N 142 GLY CA HA3 sing N N 143 GLY C O doub N N 144 GLY C OXT sing N N 145 GLY OXT HXT sing N N 146 HIS N CA sing N N 147 HIS N H sing N N 148 HIS N H2 sing N N 149 HIS CA C sing N N 150 HIS CA CB sing N N 151 HIS CA HA sing N N 152 HIS C O doub N N 153 HIS C OXT sing N N 154 HIS CB CG sing N N 155 HIS CB HB2 sing N N 156 HIS CB HB3 sing N N 157 HIS CG ND1 sing Y N 158 HIS CG CD2 doub Y N 159 HIS ND1 CE1 doub Y N 160 HIS ND1 HD1 sing N N 161 HIS CD2 NE2 sing Y N 162 HIS CD2 HD2 sing N N 163 HIS CE1 NE2 sing Y N 164 HIS CE1 HE1 sing N N 165 HIS NE2 HE2 sing N N 166 HIS OXT HXT sing N N 167 HOH O H1 sing N N 168 HOH O H2 sing N N 169 ILE N CA sing N N 170 ILE N H sing N N 171 ILE N H2 sing N N 172 ILE CA C sing N N 173 ILE CA CB sing N N 174 ILE CA HA sing N N 175 ILE C O doub N N 176 ILE C OXT sing N N 177 ILE CB CG1 sing N N 178 ILE CB CG2 sing N N 179 ILE CB HB sing N N 180 ILE CG1 CD1 sing N N 181 ILE CG1 HG12 sing N N 182 ILE CG1 HG13 sing N N 183 ILE CG2 HG21 sing N N 184 ILE CG2 HG22 sing N N 185 ILE CG2 HG23 sing N N 186 ILE CD1 HD11 sing N N 187 ILE CD1 HD12 sing N N 188 ILE CD1 HD13 sing N N 189 ILE OXT HXT sing N N 190 LEU N CA sing N N 191 LEU N H sing N N 192 LEU N H2 sing N N 193 LEU CA C sing N N 194 LEU CA CB sing N N 195 LEU CA HA sing N N 196 LEU C O doub N N 197 LEU C OXT sing N N 198 LEU CB CG sing N N 199 LEU CB HB2 sing N N 200 LEU CB HB3 sing N N 201 LEU CG CD1 sing N N 202 LEU CG CD2 sing N N 203 LEU CG HG sing N N 204 LEU CD1 HD11 sing N N 205 LEU CD1 HD12 sing N N 206 LEU CD1 HD13 sing N N 207 LEU CD2 HD21 sing N N 208 LEU CD2 HD22 sing N N 209 LEU CD2 HD23 sing N N 210 LEU OXT HXT sing N N 211 LYS N CA sing N N 212 LYS N H sing N N 213 LYS N H2 sing N N 214 LYS CA C sing N N 215 LYS CA CB sing N N 216 LYS CA HA sing N N 217 LYS C O doub N N 218 LYS C OXT sing N N 219 LYS CB CG sing N N 220 LYS CB HB2 sing N N 221 LYS CB HB3 sing N N 222 LYS CG CD sing N N 223 LYS CG HG2 sing N N 224 LYS CG HG3 sing N N 225 LYS CD CE sing N N 226 LYS CD HD2 sing N N 227 LYS CD HD3 sing N N 228 LYS CE NZ sing N N 229 LYS CE HE2 sing N N 230 LYS CE HE3 sing N N 231 LYS NZ HZ1 sing N N 232 LYS NZ HZ2 sing N N 233 LYS NZ HZ3 sing N N 234 LYS OXT HXT sing N N 235 MET N CA sing N N 236 MET N H sing N N 237 MET N H2 sing N N 238 MET CA C sing N N 239 MET CA CB sing N N 240 MET CA HA sing N N 241 MET C O doub N N 242 MET C OXT sing N N 243 MET CB CG sing N N 244 MET CB HB2 sing N N 245 MET CB HB3 sing N N 246 MET CG SD sing N N 247 MET CG HG2 sing N N 248 MET CG HG3 sing N N 249 MET SD CE sing N N 250 MET CE HE1 sing N N 251 MET CE HE2 sing N N 252 MET CE HE3 sing N N 253 MET OXT HXT sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TRP N CA sing N N 324 TRP N H sing N N 325 TRP N H2 sing N N 326 TRP CA C sing N N 327 TRP CA CB sing N N 328 TRP CA HA sing N N 329 TRP C O doub N N 330 TRP C OXT sing N N 331 TRP CB CG sing N N 332 TRP CB HB2 sing N N 333 TRP CB HB3 sing N N 334 TRP CG CD1 doub Y N 335 TRP CG CD2 sing Y N 336 TRP CD1 NE1 sing Y N 337 TRP CD1 HD1 sing N N 338 TRP CD2 CE2 doub Y N 339 TRP CD2 CE3 sing Y N 340 TRP NE1 CE2 sing Y N 341 TRP NE1 HE1 sing N N 342 TRP CE2 CZ2 sing Y N 343 TRP CE3 CZ3 doub Y N 344 TRP CE3 HE3 sing N N 345 TRP CZ2 CH2 doub Y N 346 TRP CZ2 HZ2 sing N N 347 TRP CZ3 CH2 sing Y N 348 TRP CZ3 HZ3 sing N N 349 TRP CH2 HH2 sing N N 350 TRP OXT HXT sing N N 351 TYR N CA sing N N 352 TYR N H sing N N 353 TYR N H2 sing N N 354 TYR CA C sing N N 355 TYR CA CB sing N N 356 TYR CA HA sing N N 357 TYR C O doub N N 358 TYR C OXT sing N N 359 TYR CB CG sing N N 360 TYR CB HB2 sing N N 361 TYR CB HB3 sing N N 362 TYR CG CD1 doub Y N 363 TYR CG CD2 sing Y N 364 TYR CD1 CE1 sing Y N 365 TYR CD1 HD1 sing N N 366 TYR CD2 CE2 doub Y N 367 TYR CD2 HD2 sing N N 368 TYR CE1 CZ doub Y N 369 TYR CE1 HE1 sing N N 370 TYR CE2 CZ sing Y N 371 TYR CE2 HE2 sing N N 372 TYR CZ OH sing N N 373 TYR OH HH sing N N 374 TYR OXT HXT sing N N 375 VAL N CA sing N N 376 VAL N H sing N N 377 VAL N H2 sing N N 378 VAL CA C sing N N 379 VAL CA CB sing N N 380 VAL CA HA sing N N 381 VAL C O doub N N 382 VAL C OXT sing N N 383 VAL CB CG1 sing N N 384 VAL CB CG2 sing N N 385 VAL CB HB sing N N 386 VAL CG1 HG11 sing N N 387 VAL CG1 HG12 sing N N 388 VAL CG1 HG13 sing N N 389 VAL CG2 HG21 sing N N 390 VAL CG2 HG22 sing N N 391 VAL CG2 HG23 sing N N 392 VAL OXT HXT sing N N 393 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 BGC 1 B BGC 1 A BGC 1152 n B 2 BGC 2 B BGC 2 A BGC 1151 n C 2 BGC 1 C BGC 1 A BGC 1154 n C 2 BGC 2 C BGC 2 A BGC 1155 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpb BGC 'COMMON NAME' GMML 1.0 b-D-glucopyranose BGC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Glcp BGC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpb1-3DGlcpb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5]/1-1/a3-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-Glcp]{[(3+1)][b-D-Glcp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 BGC _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 BGC _pdbx_entity_branch_link.atom_id_2 O3 _pdbx_entity_branch_link.leaving_atom_id_2 HO3 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 BGC 1 n 2 BGC 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ACETIC ACID' ACY 4 'CALCIUM ION' CA 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1NAE _pdbx_initial_refinement_model.details 'PDB ENTRY 1NAE' #