data_1OY2 # _entry.id 1OY2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1OY2 pdb_00001oy2 10.2210/pdb1oy2/pdb RCSB RCSB018789 ? ? WWPDB D_1000018789 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1N3H 'Free protein structure (residues 111-317)' unspecified PDB 1SHC 'Protein (residues 127-317) complexed to TrkA phosphopeptide' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1OY2 _pdbx_database_status.recvd_initial_deposition_date 2003-04-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Farooq, A.' 1 'Zeng, L.' 2 'Yan, K.S.' 3 'Ravichandran, K.S.' 4 'Zhou, M.-M.' 5 # _citation.id primary _citation.title 'Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc' _citation.journal_abbrev Structure _citation.journal_volume 11 _citation.page_first 905 _citation.page_last 913 _citation.year 2003 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12906822 _citation.pdbx_database_id_DOI '10.1016/S0969-2126(03)00134-5' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Farooq, A.' 1 ? primary 'Zeng, L.' 2 ? primary 'Yan, K.S.' 3 ? primary 'Ravichandran, K.S.' 4 ? primary 'Zhou, M.-M.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SHC transforming protein' _entity.formula_weight 22657.021 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PTB Domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTRE AISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDT AEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR ; _entity_poly.pdbx_seq_one_letter_code_can ;MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTRE AISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDT AEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LYS n 1 4 LEU n 1 5 SER n 1 6 GLY n 1 7 GLY n 1 8 GLY n 1 9 GLY n 1 10 ARG n 1 11 ARG n 1 12 THR n 1 13 ARG n 1 14 VAL n 1 15 GLU n 1 16 GLY n 1 17 GLY n 1 18 GLN n 1 19 LEU n 1 20 GLY n 1 21 GLY n 1 22 GLU n 1 23 GLU n 1 24 TRP n 1 25 THR n 1 26 ARG n 1 27 HIS n 1 28 GLY n 1 29 SER n 1 30 PHE n 1 31 VAL n 1 32 ASN n 1 33 LYS n 1 34 PRO n 1 35 THR n 1 36 ARG n 1 37 GLY n 1 38 TRP n 1 39 LEU n 1 40 HIS n 1 41 PRO n 1 42 ASN n 1 43 ASP n 1 44 LYS n 1 45 VAL n 1 46 MET n 1 47 GLY n 1 48 PRO n 1 49 GLY n 1 50 VAL n 1 51 SER n 1 52 TYR n 1 53 LEU n 1 54 VAL n 1 55 ARG n 1 56 TYR n 1 57 MET n 1 58 GLY n 1 59 CYS n 1 60 VAL n 1 61 GLU n 1 62 VAL n 1 63 LEU n 1 64 GLN n 1 65 SER n 1 66 MET n 1 67 ARG n 1 68 ALA n 1 69 LEU n 1 70 ASP n 1 71 PHE n 1 72 ASN n 1 73 THR n 1 74 ARG n 1 75 THR n 1 76 GLN n 1 77 VAL n 1 78 THR n 1 79 ARG n 1 80 GLU n 1 81 ALA n 1 82 ILE n 1 83 SER n 1 84 LEU n 1 85 VAL n 1 86 CYS n 1 87 GLU n 1 88 ALA n 1 89 VAL n 1 90 PRO n 1 91 GLY n 1 92 ALA n 1 93 LYS n 1 94 GLY n 1 95 ALA n 1 96 THR n 1 97 ARG n 1 98 ARG n 1 99 ARG n 1 100 LYS n 1 101 PRO n 1 102 CYS n 1 103 SER n 1 104 ARG n 1 105 PRO n 1 106 LEU n 1 107 SER n 1 108 SER n 1 109 ILE n 1 110 LEU n 1 111 GLY n 1 112 ARG n 1 113 SER n 1 114 ASN n 1 115 LEU n 1 116 LYS n 1 117 PHE n 1 118 ALA n 1 119 GLY n 1 120 MET n 1 121 PRO n 1 122 ILE n 1 123 THR n 1 124 LEU n 1 125 THR n 1 126 VAL n 1 127 SER n 1 128 THR n 1 129 SER n 1 130 SER n 1 131 LEU n 1 132 ASN n 1 133 LEU n 1 134 MET n 1 135 ALA n 1 136 ALA n 1 137 ASP n 1 138 CYS n 1 139 LYS n 1 140 GLN n 1 141 ILE n 1 142 ILE n 1 143 ALA n 1 144 ASN n 1 145 HIS n 1 146 HIS n 1 147 MET n 1 148 GLN n 1 149 SER n 1 150 ILE n 1 151 SER n 1 152 PHE n 1 153 ALA n 1 154 SER n 1 155 GLY n 1 156 GLY n 1 157 ASP n 1 158 PRO n 1 159 ASP n 1 160 THR n 1 161 ALA n 1 162 GLU n 1 163 TYR n 1 164 VAL n 1 165 ALA n 1 166 TYR n 1 167 VAL n 1 168 ALA n 1 169 LYS n 1 170 ASP n 1 171 PRO n 1 172 VAL n 1 173 ASN n 1 174 GLN n 1 175 ARG n 1 176 ALA n 1 177 CYS n 1 178 HIS n 1 179 ILE n 1 180 LEU n 1 181 GLU n 1 182 CYS n 1 183 PRO n 1 184 GLU n 1 185 GLY n 1 186 LEU n 1 187 ALA n 1 188 GLN n 1 189 ASP n 1 190 VAL n 1 191 ILE n 1 192 SER n 1 193 THR n 1 194 ILE n 1 195 GLY n 1 196 GLN n 1 197 ALA n 1 198 PHE n 1 199 GLU n 1 200 LEU n 1 201 ARG n 1 202 PHE n 1 203 LYS n 1 204 GLN n 1 205 TYR n 1 206 LEU n 1 207 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SHC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SHC1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTRE AISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDT AEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR ; _struct_ref.pdbx_align_begin 111 _struct_ref.pdbx_db_accession P29353 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1OY2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 207 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P29353 _struct_ref_seq.db_align_beg 111 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 317 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 207 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 HNHA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200mM _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5mM Shc PTB Domain, 50mM Sodium phosphate, 20mM DTT-d10' _pdbx_nmr_sample_details.solvent_system '90% D2O, 10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 500 2 ? Bruker DRX 600 # _pdbx_nmr_refine.entry_id 1OY2 _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1OY2 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1OY2 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1OY2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe ? processing ? 1 XwinNMR ? collection ? 2 X-PLOR ? 'structure solution' ? 3 ARIA ? 'structure solution' ? 4 NMRView ? 'data analysis' ? 5 ARIA ? refinement ? 6 # _exptl.entry_id 1OY2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1OY2 _struct.title 'Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1OY2 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'Free Protein, Structure Disorder, Beta Sandwich, Signaling protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 42 ? GLY A 47 ? ASN A 42 GLY A 47 1 ? 6 HELX_P HELX_P2 2 THR A 73 ? VAL A 89 ? THR A 73 VAL A 89 1 ? 17 HELX_P HELX_P3 3 PRO A 90 ? LYS A 93 ? PRO A 90 LYS A 93 5 ? 4 HELX_P HELX_P4 4 LEU A 186 ? ILE A 191 ? LEU A 186 ILE A 191 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 104 A . ? ARG 104 A PRO 105 A ? PRO 105 A 1 0.80 2 ASP 157 A . ? ASP 157 A PRO 158 A ? PRO 158 A 1 1.76 3 ASP 170 A . ? ASP 170 A PRO 171 A ? PRO 171 A 1 0.51 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 130 ? MET A 134 ? SER A 130 MET A 134 A 2 MET A 120 ? SER A 127 ? MET A 120 SER A 127 A 3 VAL A 50 ? GLU A 61 ? VAL A 50 GLU A 61 A 4 ARG A 112 ? ASN A 114 ? ARG A 112 ASN A 114 B 1 SER A 130 ? MET A 134 ? SER A 130 MET A 134 B 2 MET A 120 ? SER A 127 ? MET A 120 SER A 127 B 3 VAL A 50 ? GLU A 61 ? VAL A 50 GLU A 61 B 4 ALA A 176 ? GLU A 181 ? ALA A 176 GLU A 181 B 5 VAL A 164 ? ALA A 165 ? VAL A 164 ALA A 165 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O MET A 134 ? O MET A 134 N THR A 123 ? N THR A 123 A 2 3 O VAL A 126 ? O VAL A 126 N VAL A 50 ? N VAL A 50 A 3 4 N GLU A 61 ? N GLU A 61 O ARG A 112 ? O ARG A 112 B 1 2 O MET A 134 ? O MET A 134 N THR A 123 ? N THR A 123 B 2 3 O VAL A 126 ? O VAL A 126 N VAL A 50 ? N VAL A 50 B 3 4 N VAL A 60 ? N VAL A 60 O CYS A 177 ? O CYS A 177 B 4 5 O LEU A 180 ? O LEU A 180 N VAL A 164 ? N VAL A 164 # _database_PDB_matrix.entry_id 1OY2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1OY2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 ARG 10 10 ? ? ? A . n A 1 11 ARG 11 11 ? ? ? A . n A 1 12 THR 12 12 ? ? ? A . n A 1 13 ARG 13 13 ? ? ? A . n A 1 14 VAL 14 14 ? ? ? A . n A 1 15 GLU 15 15 ? ? ? A . n A 1 16 GLY 16 16 ? ? ? A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 CYS 138 138 138 CYS CYS A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 MET 147 147 147 MET MET A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 TYR 166 166 166 TYR TYR A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 CYS 177 177 177 CYS CYS A . n A 1 178 HIS 178 178 178 HIS HIS A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 CYS 182 182 182 CYS CYS A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 GLN 188 188 188 GLN GLN A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 GLN 196 196 196 GLN GLN A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 PHE 198 198 198 PHE PHE A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 PHE 202 202 202 PHE PHE A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 GLN 204 204 204 GLN GLN A . n A 1 205 TYR 205 205 205 TYR TYR A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ARG 207 207 207 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-06 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 18 ? ? 63.13 158.06 2 1 GLU A 22 ? ? -166.70 37.04 3 1 THR A 25 ? ? -152.59 60.52 4 1 ASN A 32 ? ? 170.10 66.19 5 1 LEU A 39 ? ? 67.88 -62.45 6 1 HIS A 40 ? ? -151.71 -81.87 7 1 GLN A 64 ? ? -45.25 161.39 8 1 SER A 65 ? ? -172.97 -68.42 9 1 ARG A 67 ? ? -67.07 82.42 10 1 ALA A 68 ? ? -124.66 -163.15 11 1 ASP A 70 ? ? -171.29 84.48 12 1 THR A 73 ? ? -168.95 31.24 13 1 VAL A 89 ? ? -119.12 78.81 14 1 LYS A 93 ? ? 56.98 102.72 15 1 THR A 96 ? ? -125.48 -164.92 16 1 ARG A 98 ? ? 61.47 -82.65 17 1 LYS A 100 ? ? -179.59 93.23 18 1 ARG A 104 ? ? 60.65 152.60 19 1 SER A 107 ? ? 74.83 170.72 20 1 LEU A 110 ? ? 64.06 157.93 21 1 ARG A 112 ? ? -179.98 138.59 22 1 LYS A 116 ? ? -42.06 99.73 23 1 PHE A 117 ? ? 70.95 54.04 24 1 THR A 128 ? ? -54.42 106.37 25 1 SER A 130 ? ? -175.33 115.07 26 1 ALA A 135 ? ? -55.41 107.27 27 1 LYS A 139 ? ? 72.91 62.65 28 1 GLN A 140 ? ? -177.28 -170.05 29 1 SER A 149 ? ? 171.60 -53.98 30 1 SER A 151 ? ? -168.78 -67.64 31 1 ASP A 157 ? ? -170.55 58.05 32 1 THR A 160 ? ? 179.45 67.75 33 1 ALA A 161 ? ? 67.04 -70.88 34 1 GLU A 162 ? ? -148.14 45.71 35 1 ASP A 170 ? ? -177.69 95.57 36 1 ASN A 173 ? ? 78.45 49.14 37 1 GLN A 174 ? ? 52.97 103.48 38 1 ARG A 175 ? ? -133.25 -61.57 39 1 SER A 192 ? ? 74.36 103.59 40 1 THR A 193 ? ? -166.47 -52.75 41 1 GLN A 196 ? ? 175.50 134.02 42 1 ALA A 197 ? ? -57.35 102.61 43 1 PHE A 198 ? ? -83.10 -157.00 44 1 GLU A 199 ? ? 80.49 49.75 45 1 LEU A 200 ? ? 179.06 106.42 46 1 GLN A 204 ? ? 52.92 173.96 47 1 LEU A 206 ? ? 49.57 25.61 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A ARG 10 ? A ARG 10 11 1 Y 1 A ARG 11 ? A ARG 11 12 1 Y 1 A THR 12 ? A THR 12 13 1 Y 1 A ARG 13 ? A ARG 13 14 1 Y 1 A VAL 14 ? A VAL 14 15 1 Y 1 A GLU 15 ? A GLU 15 16 1 Y 1 A GLY 16 ? A GLY 16 #