data_1P94 # _entry.id 1P94 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1P94 pdb_00001p94 10.2210/pdb1p94/pdb RCSB RCSB019162 ? ? WWPDB D_1000019162 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 5563 _pdbx_database_related.details 'NMR signal assignments, experimental conditions' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1P94 _pdbx_database_status.recvd_initial_deposition_date 2003-05-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Golovanov, A.P.' 1 'Barilla, D.' 2 'Golovanova, M.' 3 'Hayes, F.' 4 'Lian, L.Y.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'ParG, a protein required for active partition of bacterial plasmids, has a dimeric ribbon-helix-helix structure.' Mol.Microbiol. 50 1141 1153 2003 MOMIEE UK 0950-382X 2007 ? 14622405 10.1046/j.1365-2958.2003.03750.x 1 ;The partition system of multidrug resistance plasmid TP228 includes a novel protein that epitomizes an evolutionarily distinct subgroup of the ParA superfamily ; Mol.Microbiol. 37 528 541 2000 MOMIEE UK 0950-382X 2007 ? ? 10.1046/j.1365-2958.2000.02030.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Golovanov, A.P.' 1 ? primary 'Barilla, D.' 2 ? primary 'Golovanova, M.' 3 ? primary 'Hayes, F.' 4 ? primary 'Lian, L.Y.' 5 ? 1 'Hayes, F.' 6 ? # _cell.entry_id 1P94 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1P94 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'plasmid partition protein ParG' _entity.formula_weight 8649.849 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MSLEKAHTSVKKMTFGENRDLERVVTAPVSSGKIKRVNVNFDEEKHTRFKAACARKGTSITDVVNQLVDNWLKENE _entity_poly.pdbx_seq_one_letter_code_can MSLEKAHTSVKKMTFGENRDLERVVTAPVSSGKIKRVNVNFDEEKHTRFKAACARKGTSITDVVNQLVDNWLKENE _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 GLU n 1 5 LYS n 1 6 ALA n 1 7 HIS n 1 8 THR n 1 9 SER n 1 10 VAL n 1 11 LYS n 1 12 LYS n 1 13 MET n 1 14 THR n 1 15 PHE n 1 16 GLY n 1 17 GLU n 1 18 ASN n 1 19 ARG n 1 20 ASP n 1 21 LEU n 1 22 GLU n 1 23 ARG n 1 24 VAL n 1 25 VAL n 1 26 THR n 1 27 ALA n 1 28 PRO n 1 29 VAL n 1 30 SER n 1 31 SER n 1 32 GLY n 1 33 LYS n 1 34 ILE n 1 35 LYS n 1 36 ARG n 1 37 VAL n 1 38 ASN n 1 39 VAL n 1 40 ASN n 1 41 PHE n 1 42 ASP n 1 43 GLU n 1 44 GLU n 1 45 LYS n 1 46 HIS n 1 47 THR n 1 48 ARG n 1 49 PHE n 1 50 LYS n 1 51 ALA n 1 52 ALA n 1 53 CYS n 1 54 ALA n 1 55 ARG n 1 56 LYS n 1 57 GLY n 1 58 THR n 1 59 SER n 1 60 ILE n 1 61 THR n 1 62 ASP n 1 63 VAL n 1 64 VAL n 1 65 ASN n 1 66 GLN n 1 67 LEU n 1 68 VAL n 1 69 ASP n 1 70 ASN n 1 71 TRP n 1 72 LEU n 1 73 LYS n 1 74 GLU n 1 75 ASN n 1 76 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Salmonella _entity_src_gen.pdbx_gene_src_gene parG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella enterica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 28901 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-22-b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9KJ82_SALNE _struct_ref.pdbx_db_accession Q9KJ82 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSLEKAHTSVKKMTFGENRDLERVVTAPVSSGKIKRVNVNFDEEKHTRFKAACARKGTSITDVVNQLVDNWLKENE _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1P94 A 1 ? 76 ? Q9KJ82 1 ? 76 ? 1 76 2 1 1P94 B 1 ? 76 ? Q9KJ82 1 ? 76 ? 1 76 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 3 1 3D_15N-separated_NOESY 3 2 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '150 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM ParG U-15N,13C; 100 mM NaCl, 50 mM phosphate buffer, 1 mM DTT; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1 mM ParG U-15N; 100 mM NaCl, 50 mM phosphate buffer, 1 mM DTT; 100% D2O' '100% D2O' 3 '1 mM ParG U-15N; 100 mM NaCl, 50 mM phosphate buffer, 1 mM DTT; 90% H2O, 10% D2O' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker DRX 800 3 ? Varian INOVA 800 # _pdbx_nmr_refine.entry_id 1P94 _pdbx_nmr_refine.method ;ARIA protocol (Nilges, M. et al., (1997) J. Mol. Biol. 269, 408-422) was used to deal with ambiguous distance restraints and for some NOE assignments. ; _pdbx_nmr_refine.details ;The ParG structure is based on 2230 ambiguous NOE restraints, 82 hydrogen bond restraints, and 144 CSI-based dihedral angle restraints. N-terminal region of ParG (1-32) is unstructured. The C-terminal region (33-76) is structured. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1P94 _pdbx_nmr_details.text ;BEST REPRESENTATIVE CONFORMER (MODEL 1) IN THIS ENSEMBLE WAS OBTAINED BY ENERGY MINIMIZATION OF THE AVERAGE STRUCTURE, CALCULATED FOR MODELS 2-11 ; # _pdbx_nmr_ensemble.entry_id 1P94 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 11 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1P94 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe ? processing 'Delaglio et al.' 1 NMRView 5.01 'data analysis' 'Johnson and Blevins' 2 ARIA 1.1 'structure solution' 'Nilges et al.' 3 CNS 1.0 'structure solution' 'Brunger et al.' 4 CNS 1.0 refinement 'Brunger et al.' 5 # _exptl.entry_id 1P94 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1P94 _struct.title 'NMR Structure of ParG symmetric dimer' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1P94 _struct_keywords.pdbx_keywords 'CELL CYCLE' _struct_keywords.text 'ribbon-helix-helix, dimer, DNA binding, CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 43 ? GLY A 57 ? GLU A 43 GLY A 57 1 ? 15 HELX_P HELX_P2 2 SER A 59 ? ASN A 75 ? SER A 59 ASN A 75 1 ? 17 HELX_P HELX_P3 3 GLU B 43 ? GLY B 57 ? GLU B 43 GLY B 57 1 ? 15 HELX_P HELX_P4 4 SER B 59 ? ASN B 75 ? SER B 59 ASN B 75 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 34 ? ASP A 42 ? ILE A 34 ASP A 42 A 2 ILE B 34 ? ASP B 42 ? ILE B 34 ASP B 42 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 35 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 35 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id B _pdbx_struct_sheet_hbond.range_2_label_seq_id 41 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id B _pdbx_struct_sheet_hbond.range_2_auth_seq_id 41 # _database_PDB_matrix.entry_id 1P94 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1P94 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 GLU 76 76 76 GLU GLU A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 LEU 3 3 3 LEU LEU B . n B 1 4 GLU 4 4 4 GLU GLU B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 ALA 6 6 6 ALA ALA B . n B 1 7 HIS 7 7 7 HIS HIS B . n B 1 8 THR 8 8 8 THR THR B . n B 1 9 SER 9 9 9 SER SER B . n B 1 10 VAL 10 10 10 VAL VAL B . n B 1 11 LYS 11 11 11 LYS LYS B . n B 1 12 LYS 12 12 12 LYS LYS B . n B 1 13 MET 13 13 13 MET MET B . n B 1 14 THR 14 14 14 THR THR B . n B 1 15 PHE 15 15 15 PHE PHE B . n B 1 16 GLY 16 16 16 GLY GLY B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 ASN 18 18 18 ASN ASN B . n B 1 19 ARG 19 19 19 ARG ARG B . n B 1 20 ASP 20 20 20 ASP ASP B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 GLU 22 22 22 GLU GLU B . n B 1 23 ARG 23 23 23 ARG ARG B . n B 1 24 VAL 24 24 24 VAL VAL B . n B 1 25 VAL 25 25 25 VAL VAL B . n B 1 26 THR 26 26 26 THR THR B . n B 1 27 ALA 27 27 27 ALA ALA B . n B 1 28 PRO 28 28 28 PRO PRO B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 SER 30 30 30 SER SER B . n B 1 31 SER 31 31 31 SER SER B . n B 1 32 GLY 32 32 32 GLY GLY B . n B 1 33 LYS 33 33 33 LYS LYS B . n B 1 34 ILE 34 34 34 ILE ILE B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 ARG 36 36 36 ARG ARG B . n B 1 37 VAL 37 37 37 VAL VAL B . n B 1 38 ASN 38 38 38 ASN ASN B . n B 1 39 VAL 39 39 39 VAL VAL B . n B 1 40 ASN 40 40 40 ASN ASN B . n B 1 41 PHE 41 41 41 PHE PHE B . n B 1 42 ASP 42 42 42 ASP ASP B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 LYS 45 45 45 LYS LYS B . n B 1 46 HIS 46 46 46 HIS HIS B . n B 1 47 THR 47 47 47 THR THR B . n B 1 48 ARG 48 48 48 ARG ARG B . n B 1 49 PHE 49 49 49 PHE PHE B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 ALA 51 51 51 ALA ALA B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 CYS 53 53 53 CYS CYS B . n B 1 54 ALA 54 54 54 ALA ALA B . n B 1 55 ARG 55 55 55 ARG ARG B . n B 1 56 LYS 56 56 56 LYS LYS B . n B 1 57 GLY 57 57 57 GLY GLY B . n B 1 58 THR 58 58 58 THR THR B . n B 1 59 SER 59 59 59 SER SER B . n B 1 60 ILE 60 60 60 ILE ILE B . n B 1 61 THR 61 61 61 THR THR B . n B 1 62 ASP 62 62 62 ASP ASP B . n B 1 63 VAL 63 63 63 VAL VAL B . n B 1 64 VAL 64 64 64 VAL VAL B . n B 1 65 ASN 65 65 65 ASN ASN B . n B 1 66 GLN 66 66 66 GLN GLN B . n B 1 67 LEU 67 67 67 LEU LEU B . n B 1 68 VAL 68 68 68 VAL VAL B . n B 1 69 ASP 69 69 69 ASP ASP B . n B 1 70 ASN 70 70 70 ASN ASN B . n B 1 71 TRP 71 71 71 TRP TRP B . n B 1 72 LEU 72 72 72 LEU LEU B . n B 1 73 LYS 73 73 73 LYS LYS B . n B 1 74 GLU 74 74 74 GLU GLU B . n B 1 75 ASN 75 75 75 ASN ASN B . n B 1 76 GLU 76 76 76 GLU GLU B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-01-13 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR ; 700 ;SHEET DETERMINATION METHOD: AUTHOR ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD2 A LYS 11 ? ? H A MET 13 ? ? 1.34 2 2 HA B VAL 64 ? ? HD12 B LEU 67 ? ? 1.24 3 2 HZ1 A LYS 45 ? ? OD1 B ASP 69 ? ? 1.59 4 3 HG1 B THR 58 ? ? OD2 B ASP 62 ? ? 1.59 5 3 OE1 B GLU 4 ? ? HE2 B HIS 7 ? ? 1.59 6 4 HZ1 A LYS 45 ? ? OD1 B ASP 69 ? ? 1.60 7 5 OD2 B ASP 69 ? ? HZ1 B LYS 73 ? ? 1.57 8 7 HA B VAL 64 ? ? HD13 B LEU 67 ? ? 1.15 9 7 HB3 A TRP 71 ? ? HD23 B LEU 67 ? ? 1.27 10 9 HZ1 A LYS 45 ? ? OD1 B ASP 69 ? ? 1.59 11 10 OD1 A ASP 69 ? ? HZ1 A LYS 73 ? ? 1.58 12 11 OD2 A ASP 69 ? ? HZ2 B LYS 45 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 7 ? ? -103.25 45.26 2 1 VAL A 10 ? ? -40.12 -74.36 3 1 LYS A 12 ? ? 145.99 8.21 4 1 MET A 13 ? ? 54.66 15.63 5 1 THR A 14 ? ? 45.59 27.04 6 1 GLU A 22 ? ? 54.23 73.62 7 1 THR A 26 ? ? -63.81 78.92 8 1 ALA A 27 ? ? -47.39 155.74 9 1 VAL A 29 ? ? 73.85 -55.55 10 1 VAL A 37 ? ? -146.47 -37.47 11 1 ASN A 38 ? ? 57.48 103.97 12 1 LEU B 3 ? ? -85.21 35.69 13 1 GLU B 4 ? ? 61.07 -25.14 14 1 LYS B 5 ? ? 65.63 -13.86 15 1 VAL B 10 ? ? 76.98 57.54 16 1 LYS B 11 ? ? 52.31 88.33 17 1 LYS B 12 ? ? 38.73 35.80 18 1 MET B 13 ? ? 48.03 89.65 19 1 GLU B 22 ? ? 31.99 37.85 20 1 ARG B 23 ? ? -77.06 35.91 21 1 VAL B 25 ? ? 26.89 55.64 22 1 THR B 26 ? ? -39.30 -32.83 23 1 ALA B 27 ? ? 12.94 69.93 24 1 PRO B 28 ? ? -29.01 80.90 25 2 SER A 2 ? ? 70.06 -75.41 26 2 SER A 9 ? ? 56.17 -147.16 27 2 SER A 31 ? ? 57.40 72.73 28 2 LYS A 33 ? ? -115.57 59.54 29 2 ALA B 6 ? ? 69.43 -169.58 30 2 HIS B 7 ? ? -170.38 143.33 31 2 SER B 9 ? ? 62.90 115.16 32 2 PRO B 28 ? ? -75.08 -168.17 33 2 SER B 31 ? ? 52.78 -138.97 34 3 HIS A 7 ? ? -141.26 52.35 35 3 MET A 13 ? ? -100.86 58.26 36 3 LEU A 21 ? ? -149.41 36.10 37 3 MET B 13 ? ? -95.60 38.03 38 3 ARG B 19 ? ? 55.42 80.18 39 4 SER A 2 ? ? -75.25 48.09 40 4 LEU A 3 ? ? -154.83 -84.19 41 4 LYS A 5 ? ? -121.71 -156.35 42 4 LYS A 11 ? ? -124.79 -163.83 43 4 LEU B 3 ? ? -70.93 -70.98 44 4 HIS B 7 ? ? 70.65 40.31 45 5 SER A 2 ? ? -145.90 36.14 46 5 LYS A 5 ? ? 67.10 96.83 47 5 LYS A 11 ? ? 73.28 -74.80 48 5 GLU A 17 ? ? 55.32 72.33 49 5 LEU A 21 ? ? -152.27 28.85 50 5 LYS B 5 ? ? 66.82 93.24 51 5 LYS B 11 ? ? 64.44 -89.28 52 5 LYS B 12 ? ? -173.16 105.37 53 6 ALA A 6 ? ? 63.68 -173.31 54 6 VAL A 10 ? ? -140.72 -159.46 55 6 ARG A 19 ? ? 59.01 81.50 56 6 ASP A 20 ? ? -113.73 73.00 57 6 THR A 26 ? ? -97.88 51.76 58 6 SER B 2 ? ? -75.27 -70.18 59 6 PHE B 15 ? ? -138.19 -33.05 60 6 GLU B 17 ? ? -102.11 50.68 61 7 GLU A 4 ? ? 73.54 -63.71 62 7 VAL A 29 ? ? -102.27 40.46 63 7 SER A 31 ? ? -80.70 -150.80 64 7 SER B 2 ? ? 60.22 -100.19 65 7 GLU B 4 ? ? 59.13 -99.82 66 7 LYS B 11 ? ? -93.71 45.18 67 7 LEU B 21 ? ? -152.14 60.79 68 7 VAL B 24 ? ? -105.23 74.50 69 8 LEU A 3 ? ? -101.49 79.33 70 8 LEU A 21 ? ? -168.20 109.30 71 8 ASN A 75 ? ? -98.09 -60.09 72 8 GLU B 4 ? ? -112.16 68.82 73 8 HIS B 7 ? ? -145.02 55.86 74 8 PHE B 15 ? ? -151.61 -25.75 75 8 THR B 26 ? ? -119.85 78.76 76 8 VAL B 29 ? ? 60.32 92.23 77 9 ALA A 6 ? ? -137.17 -71.32 78 9 ARG A 19 ? ? -85.86 49.28 79 9 VAL A 25 ? ? -114.18 66.99 80 9 ALA B 6 ? ? -160.81 -107.85 81 9 SER B 31 ? ? -114.74 78.43 82 10 LEU A 3 ? ? 72.95 -50.39 83 10 LYS A 5 ? ? -144.56 22.13 84 10 HIS A 7 ? ? -97.46 55.31 85 10 LYS A 12 ? ? -161.89 92.40 86 10 ARG A 19 ? ? 65.18 113.99 87 10 ASP A 20 ? ? -110.60 61.36 88 10 LEU B 3 ? ? 72.29 -72.55 89 10 LYS B 11 ? ? 72.95 -54.12 90 10 MET B 13 ? ? -119.55 -169.20 91 10 ARG B 19 ? ? 60.47 78.67 92 11 ASN A 18 ? ? -79.34 -75.88 93 11 THR A 26 ? ? -120.00 67.69 94 11 ALA B 6 ? ? -100.12 72.02 95 11 HIS B 7 ? ? -91.68 40.96 96 11 LYS B 33 ? ? -86.88 41.50 #