data_1PIC # _entry.id 1PIC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PIC pdb_00001pic 10.2210/pdb1pic/pdb WWPDB D_1000175691 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PIC _pdbx_database_status.recvd_initial_deposition_date 1997-06-23 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Breeze, A.L.' 1 'Kara, B.V.' 2 'Barratt, D.G.' 3 'Anderson, M.' 4 'Smith, J.C.' 5 'Luke, R.W.' 6 'Best, J.R.' 7 'Cartlidge, S.A.' 8 # _citation.id primary _citation.title ;Structure of a specific peptide complex of the carboxy-terminal SH2 domain from the p85 alpha subunit of phosphatidylinositol 3-kinase. ; _citation.journal_abbrev 'EMBO J.' _citation.journal_volume 15 _citation.page_first 3579 _citation.page_last 3589 _citation.year 1996 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 8670861 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Breeze, A.L.' 1 ? primary 'Kara, B.V.' 2 ? primary 'Barratt, D.G.' 3 ? primary 'Anderson, M.' 4 ? primary 'Smith, J.C.' 5 ? primary 'Luke, R.W.' 6 ? primary 'Best, J.R.' 7 ? primary 'Cartlidge, S.A.' 8 ? # _cell.entry_id 1PIC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1PIC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PHOSPHATIDYLINOSITOL 3-KINASE' 12612.094 1 2.7.1.137 ? 'C-TERMINAL SH2 DOMAIN, RESIDUES 617 - 724 OF P85-ALPHA REGULATORY SUBUNIT' 'CONTAINS AN N-TERMINAL EXTENSION (GSPI) DERIVED FROM THE RECOMBINANT EXPRESSION VECTOR' 2 polymer man 'BETA-PLATELET-DERIVED GROWTH FACTOR RECEPTOR' 727.805 1 ? ? 'ACETYL-PTYR-VAL-PRO-MET-LEU, RESIDUES 751 - 755' 'TYROSINE-PHOSPHORYLATED PEPTIDE INCORPORATES AN N-TERMINAL ACETYL GROUP' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSPIPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLK ELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR ; ;GSPIPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLK ELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR ; A ? 2 'polypeptide(L)' no yes '(ACE)(PTR)VPML' XYVPML B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 ILE n 1 5 PRO n 1 6 HIS n 1 7 HIS n 1 8 ASP n 1 9 GLU n 1 10 LYS n 1 11 THR n 1 12 TRP n 1 13 ASN n 1 14 VAL n 1 15 GLY n 1 16 SER n 1 17 SER n 1 18 ASN n 1 19 ARG n 1 20 ASN n 1 21 LYS n 1 22 ALA n 1 23 GLU n 1 24 ASN n 1 25 LEU n 1 26 LEU n 1 27 ARG n 1 28 GLY n 1 29 LYS n 1 30 ARG n 1 31 ASP n 1 32 GLY n 1 33 THR n 1 34 PHE n 1 35 LEU n 1 36 VAL n 1 37 ARG n 1 38 GLU n 1 39 SER n 1 40 SER n 1 41 LYS n 1 42 GLN n 1 43 GLY n 1 44 CYS n 1 45 TYR n 1 46 ALA n 1 47 CYS n 1 48 SER n 1 49 VAL n 1 50 VAL n 1 51 VAL n 1 52 ASP n 1 53 GLY n 1 54 GLU n 1 55 VAL n 1 56 LYS n 1 57 HIS n 1 58 CYS n 1 59 VAL n 1 60 ILE n 1 61 ASN n 1 62 LYS n 1 63 THR n 1 64 ALA n 1 65 THR n 1 66 GLY n 1 67 TYR n 1 68 GLY n 1 69 PHE n 1 70 ALA n 1 71 GLU n 1 72 PRO n 1 73 TYR n 1 74 ASN n 1 75 LEU n 1 76 TYR n 1 77 SER n 1 78 SER n 1 79 LEU n 1 80 LYS n 1 81 GLU n 1 82 LEU n 1 83 VAL n 1 84 LEU n 1 85 HIS n 1 86 TYR n 1 87 GLN n 1 88 HIS n 1 89 THR n 1 90 SER n 1 91 LEU n 1 92 VAL n 1 93 GLN n 1 94 HIS n 1 95 ASN n 1 96 ASP n 1 97 SER n 1 98 LEU n 1 99 ASN n 1 100 VAL n 1 101 THR n 1 102 LEU n 1 103 ALA n 1 104 TYR n 1 105 PRO n 1 106 VAL n 1 107 TYR n 1 108 ALA n 1 109 GLN n 1 110 GLN n 1 111 ARG n 1 112 ARG n 2 1 ACE n 2 2 PTR n 2 3 VAL n 2 4 PRO n 2 5 MET n 2 6 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'W3110 (CGSC 6564)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 UNP P85A_HUMAN 1 P27986 1 ;MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRK KISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAE LRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANN GMNNNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSS VVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREID KRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRG KRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA QQRR ; ? 2 PDB 1PIC 2 1PIC ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1PIC A 5 ? 112 ? P27986 617 ? 724 ? 5 112 2 2 1PIC B 1 ? 6 ? 1PIC 200 ? 205 ? 200 205 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 UNITY Varian 600 2 UNITY Varian 750 # _pdbx_nmr_refine.entry_id 1PIC _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1PIC _pdbx_nmr_details.text ;THE STRUCTURE WAS DETERMINED BY TRIPLE-RESONANCE NMR ON 13C,15N-LABELLED SH2 DOMAIN COMBINED WITH ISOTOPE-FILTERED 1H-NMR FOR THE UNLABELLED BOUND PEPTIDE. ; # _pdbx_nmr_ensemble.entry_id 1PIC _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 1PIC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1PIC _struct.title ;PHOSPHATIDYLINOSITOL 3-KINASE, P85-ALPHA SUBUNIT: C-TERMINAL SH2 DOMAIN COMPLEXED WITH A TYR751 PHOSPHOPEPTIDE FROM THE PDGF RECEPTOR, NMR, MINIMIZED MEAN STRUCTURE ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PIC _struct_keywords.pdbx_keywords 'COMPLEX (PHOSPHOTRANSFERASE/RECEPTOR)' _struct_keywords.text ;PHOSPHOTRANSFERASE, SH2 DOMAIN, SIGNAL TRANSDUCTION, PHOSPHOINOSITIDE 3-KINASE, COMPLEX (PHOSPHOTRANSFERASE-RECEPTOR), COMPLEX (PHOSPHOTRANSFERASE-RECEPTOR) complex ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 19 ? LEU A 26 ? ARG A 19 LEU A 26 1 ? 8 HELX_P HELX_P2 2 LEU A 79 ? HIS A 88 ? LEU A 79 HIS A 88 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ACE 1 C ? ? ? 1_555 B PTR 2 N ? ? B ACE 200 B PTR 201 1_555 ? ? ? ? ? ? ? 1.306 ? ? covale2 covale both ? B PTR 2 C ? ? ? 1_555 B VAL 3 N ? ? B PTR 201 B VAL 202 1_555 ? ? ? ? ? ? ? 1.304 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 34 ? ARG A 37 ? PHE A 34 ARG A 37 A 2 ALA A 46 ? VAL A 51 ? ALA A 46 VAL A 51 A 3 GLU A 54 ? VAL A 59 ? GLU A 54 VAL A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 35 ? O LEU A 35 N SER A 48 ? N SER A 48 A 2 3 O CYS A 47 ? O CYS A 47 N CYS A 58 ? N CYS A 58 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id B _struct_site.pdbx_auth_comp_id ACE _struct_site.pdbx_auth_seq_id 200 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE ACE B 200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 HIS A 57 ? HIS A 57 . ? 1_555 ? 2 AC1 2 VAL B 3 ? VAL B 202 . ? 1_555 ? # _database_PDB_matrix.entry_id 1PIC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1PIC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 ARG 112 112 112 ARG ARG A . n B 2 1 ACE 1 200 200 ACE ACE B . n B 2 2 PTR 2 201 201 PTR PTR B . n B 2 3 VAL 3 202 202 VAL VAL B . n B 2 4 PRO 4 203 203 PRO PRO B . n B 2 5 MET 5 204 204 MET MET B . n B 2 6 LEU 6 205 205 LEU LEU B . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 2 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 201 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-09-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 17 ? ? 87.68 52.08 2 1 ASN A 18 ? ? -155.83 57.37 3 1 ARG A 19 ? ? -78.33 -71.30 4 1 ARG A 27 ? ? -57.75 89.09 5 1 LYS A 29 ? ? -57.11 -176.14 6 1 GLU A 38 ? ? -125.04 -161.17 7 1 SER A 39 ? ? -177.57 -157.48 8 1 LYS A 41 ? ? -52.88 -178.33 9 1 CYS A 44 ? ? -75.45 -166.76 10 1 LYS A 62 ? ? -132.90 -55.41 11 1 THR A 65 ? ? -172.00 -29.64 12 1 ALA A 70 ? ? 166.54 -26.46 13 1 ASN A 74 ? ? 49.03 -159.30 14 1 LEU A 75 ? ? -129.42 -109.86 15 1 TYR A 76 ? ? 73.32 122.41 16 1 SER A 77 ? ? -101.40 41.54 17 1 LEU A 98 ? ? -107.25 -77.68 18 1 ALA A 108 ? ? 43.20 -166.92 19 1 GLN A 109 ? ? 174.02 45.25 20 1 ARG A 111 ? ? -111.62 -94.39 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 19 ? ? 0.245 'SIDE CHAIN' 2 1 ARG A 27 ? ? 0.282 'SIDE CHAIN' 3 1 ARG A 30 ? ? 0.284 'SIDE CHAIN' 4 1 ARG A 37 ? ? 0.244 'SIDE CHAIN' 5 1 ARG A 112 ? ? 0.285 'SIDE CHAIN' #