data_1PU3 # _entry.id 1PU3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PU3 pdb_00001pu3 10.2210/pdb1pu3/pdb RCSB RCSB019565 ? ? WWPDB D_1000019565 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 4371 '1H,13C,15N chemical shifts assignments of the same protein' unspecified BMRB 5835 'HNHA coupling constants of the same protein' unspecified PDB 1ONC 'X-ray crystal structure of the native onconase' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PU3 _pdbx_database_status.recvd_initial_deposition_date 2003-06-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gorbatyuk, V.Y.' 1 'Tsai, C.K.' 2 'Chang, C.F.' 3 'Huang, T.H.' 4 # _citation.id primary _citation.title 'Effect of N-terminal and Met23 Mutations on the Structure and Dynamics of Onconase' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 279 _citation.page_first 5772 _citation.page_last 5780 _citation.year 2004 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14645226 _citation.pdbx_database_id_DOI 10.1074/jbc.M311233200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gorbatyuk, V.Y.' 1 ? primary 'Tsai, C.K.' 2 ? primary 'Chang, C.F.' 3 ? primary 'Huang, T.H.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'P-30 protein' _entity.formula_weight 11975.836 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.27.- _entity.pdbx_mutation M23L _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Onconase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MQDWLTFQKKHITNTRDVDCDNILSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKL KKSTNKFCVTCENQAPVHFVGVGSC ; _entity_poly.pdbx_seq_one_letter_code_can ;MQDWLTFQKKHITNTRDVDCDNILSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKL KKSTNKFCVTCENQAPVHFVGVGSC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 ASP n 1 4 TRP n 1 5 LEU n 1 6 THR n 1 7 PHE n 1 8 GLN n 1 9 LYS n 1 10 LYS n 1 11 HIS n 1 12 ILE n 1 13 THR n 1 14 ASN n 1 15 THR n 1 16 ARG n 1 17 ASP n 1 18 VAL n 1 19 ASP n 1 20 CYS n 1 21 ASP n 1 22 ASN n 1 23 ILE n 1 24 LEU n 1 25 SER n 1 26 THR n 1 27 ASN n 1 28 LEU n 1 29 PHE n 1 30 HIS n 1 31 CYS n 1 32 LYS n 1 33 ASP n 1 34 LYS n 1 35 ASN n 1 36 THR n 1 37 PHE n 1 38 ILE n 1 39 TYR n 1 40 SER n 1 41 ARG n 1 42 PRO n 1 43 GLU n 1 44 PRO n 1 45 VAL n 1 46 LYS n 1 47 ALA n 1 48 ILE n 1 49 CYS n 1 50 LYS n 1 51 GLY n 1 52 ILE n 1 53 ILE n 1 54 ALA n 1 55 SER n 1 56 LYS n 1 57 ASN n 1 58 VAL n 1 59 LEU n 1 60 THR n 1 61 THR n 1 62 SER n 1 63 GLU n 1 64 PHE n 1 65 TYR n 1 66 LEU n 1 67 SER n 1 68 ASP n 1 69 CYS n 1 70 ASN n 1 71 VAL n 1 72 THR n 1 73 SER n 1 74 ARG n 1 75 PRO n 1 76 CYS n 1 77 LYS n 1 78 TYR n 1 79 LYS n 1 80 LEU n 1 81 LYS n 1 82 LYS n 1 83 SER n 1 84 THR n 1 85 ASN n 1 86 LYS n 1 87 PHE n 1 88 CYS n 1 89 VAL n 1 90 THR n 1 91 CYS n 1 92 GLU n 1 93 ASN n 1 94 GLN n 1 95 ALA n 1 96 PRO n 1 97 VAL n 1 98 HIS n 1 99 PHE n 1 100 VAL n 1 101 GLY n 1 102 VAL n 1 103 GLY n 1 104 SER n 1 105 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'northern leopard frog' _entity_src_gen.gene_src_genus Rana _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rana pipiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8404 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-11d _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RN30_RANPI _struct_ref.pdbx_db_accession P22069 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLK KSTNKFCVTCENQAPVHFVGVGSC ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PU3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22069 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1PU3 MET A 1 ? UNP P22069 ? ? 'cloning artifact' 1 1 1 1PU3 LEU A 24 ? UNP P22069 MET 23 'engineered mutation' 24 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 HNHA 2 1 1 3D_15N-separated_NOESY 3 1 1 3D_13C-separated_NOESY 4 1 1 '2D TOCSY' 5 1 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.3 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.5 mM (M-1, Q1, M23L)rONC [U-15N; U-13C]' _pdbx_nmr_sample_details.solvent_system '50mM phosphate buffer pH4.1, 90% H2O, 10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1PU3 _pdbx_nmr_refine.method 'simulated annealing, matrix relaxation, torsion angle dymanics' _pdbx_nmr_refine.details ;the structures are based on a total of 1802 restraints, 1550 are NOE-derived distance constraints, 4 disulfide bonds, 150 dihedral angle restraints, 98 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1PU3 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1PU3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal ARIA 1.2 'structure solution' Nilges 1 CNS 1.1 'structure solution' Brunger 2 CNS 1.1 refinement Brunger 3 # _exptl.entry_id 1PU3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1PU3 _struct.title 'The Solution NMR Structure and Dynamics of a Recombinant Onconase with Altered N-terminal and Met23 residues' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1PU3 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'bowl-shaped folding of the two sheets, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 3 ? HIS A 11 ? ASP A 3 HIS A 11 1 ? 9 HELX_P HELX_P2 2 ASP A 19 ? LEU A 24 ? ASP A 19 LEU A 24 1 ? 6 HELX_P HELX_P3 3 ARG A 41 ? ALA A 47 ? ARG A 41 ALA A 47 1 ? 7 HELX_P HELX_P4 4 ILE A 48 ? LYS A 50 ? ILE A 48 LYS A 50 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 69 SG ? ? A CYS 20 A CYS 69 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 76 SG ? ? A CYS 31 A CYS 76 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf3 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 91 SG ? ? A CYS 49 A CYS 91 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf4 disulf ? ? A CYS 88 SG ? ? ? 1_555 A CYS 105 SG ? ? A CYS 88 A CYS 105 1_555 ? ? ? ? ? ? ? 2.027 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 12 ? THR A 13 ? ILE A 12 THR A 13 A 2 LYS A 34 ? TYR A 39 ? LYS A 34 TYR A 39 A 3 PHE A 64 ? VAL A 71 ? PHE A 64 VAL A 71 A 4 TYR A 78 ? ASN A 85 ? TYR A 78 ASN A 85 B 1 LYS A 56 ? LEU A 59 ? LYS A 56 LEU A 59 B 2 PHE A 87 ? GLU A 92 ? PHE A 87 GLU A 92 B 3 ALA A 95 ? VAL A 102 ? ALA A 95 VAL A 102 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 13 ? N THR A 13 O ILE A 38 ? O ILE A 38 A 2 3 N TYR A 39 ? N TYR A 39 O TYR A 65 ? O TYR A 65 A 3 4 N ASP A 68 ? N ASP A 68 O LYS A 81 ? O LYS A 81 B 1 2 N LYS A 56 ? N LYS A 56 O CYS A 91 ? O CYS A 91 B 2 3 N THR A 90 ? N THR A 90 O HIS A 98 ? O HIS A 98 # _database_PDB_matrix.entry_id 1PU3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1PU3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 CYS 105 105 105 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-03-16 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 17 ? ? HZ1 A LYS 82 ? ? 1.58 2 2 OE1 A GLU 63 ? ? HZ2 A LYS 86 ? ? 1.59 3 4 OE2 A GLU 63 ? ? HZ1 A LYS 86 ? ? 1.59 4 7 HA A ASP 21 ? ? HD2 A TYR 78 ? ? 1.34 5 8 OD1 A ASP 3 ? ? HG1 A THR 6 ? ? 1.60 6 9 O A LYS 86 ? ? H A GLY 103 ? ? 1.59 7 15 HA A CYS 31 ? ? HH A TYR 78 ? ? 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 35 ? ? -161.56 115.79 2 1 SER A 55 ? ? -51.81 105.02 3 1 THR A 72 ? ? -89.24 -136.64 4 1 VAL A 100 ? ? -95.54 -65.57 5 2 PHE A 29 ? ? -136.01 -30.13 6 2 SER A 40 ? ? -175.17 148.17 7 2 SER A 55 ? ? -51.44 105.99 8 2 THR A 72 ? ? -93.90 -145.59 9 3 ASN A 27 ? ? -76.74 25.43 10 3 PHE A 29 ? ? -133.98 -36.02 11 3 SER A 55 ? ? -51.56 105.57 12 3 THR A 72 ? ? -114.52 -82.32 13 3 SER A 73 ? ? -94.71 -63.53 14 3 VAL A 100 ? ? -80.13 -79.48 15 4 SER A 55 ? ? -51.93 104.13 16 4 THR A 72 ? ? -97.50 -99.17 17 4 VAL A 100 ? ? -90.64 -72.39 18 5 PHE A 29 ? ? -135.63 -33.91 19 5 CYS A 31 ? ? 38.78 62.72 20 5 THR A 72 ? ? -87.26 -140.72 21 6 CYS A 31 ? ? 60.19 74.15 22 6 SER A 55 ? ? -51.56 108.61 23 6 THR A 72 ? ? -114.60 -105.48 24 6 PRO A 96 ? ? -59.94 106.40 25 6 VAL A 100 ? ? -79.81 -72.96 26 7 ASN A 27 ? ? -78.50 25.25 27 7 ASN A 35 ? ? -162.41 117.78 28 7 SER A 55 ? ? -51.13 105.95 29 7 THR A 72 ? ? -92.67 -98.31 30 8 CYS A 31 ? ? 40.40 79.42 31 8 SER A 40 ? ? -176.59 -177.26 32 8 SER A 55 ? ? -50.29 105.51 33 8 THR A 72 ? ? -114.32 -113.05 34 9 GLN A 2 ? ? 64.57 112.76 35 9 SER A 55 ? ? -51.30 106.96 36 9 THR A 72 ? ? -88.89 -152.69 37 10 ASP A 3 ? ? -170.05 -177.72 38 10 SER A 40 ? ? -170.45 -177.50 39 10 SER A 55 ? ? -50.85 102.43 40 10 THR A 72 ? ? -90.69 -106.53 41 11 CYS A 31 ? ? 41.26 72.15 42 11 SER A 55 ? ? -50.68 108.60 43 11 THR A 72 ? ? -88.29 -144.54 44 12 SER A 55 ? ? -51.39 109.60 45 12 THR A 72 ? ? -97.67 -133.53 46 13 HIS A 11 ? ? -140.77 -13.79 47 13 SER A 40 ? ? -177.14 -172.36 48 13 SER A 55 ? ? -51.89 106.19 49 13 THR A 72 ? ? -95.58 -142.88 50 14 THR A 72 ? ? -114.36 -108.63 51 14 VAL A 100 ? ? -92.04 -64.82 52 15 PHE A 29 ? ? -130.28 -35.16 53 15 CYS A 31 ? ? 48.17 79.74 54 15 LYS A 32 ? ? -77.11 -168.99 55 15 SER A 55 ? ? -48.82 101.07 56 15 THR A 72 ? ? -87.30 -142.37 57 16 PHE A 29 ? ? -133.47 -30.46 58 16 CYS A 31 ? ? 61.14 69.72 59 16 SER A 40 ? ? -174.94 147.96 60 16 SER A 55 ? ? -51.27 108.66 61 16 THR A 72 ? ? -88.59 -135.00 62 17 SER A 40 ? ? -177.56 -175.79 63 17 SER A 55 ? ? -50.80 106.53 64 17 THR A 72 ? ? -117.19 -102.07 65 17 VAL A 100 ? ? -102.41 -70.22 66 18 GLN A 2 ? ? 68.44 156.90 67 18 PHE A 29 ? ? -132.50 -46.95 68 18 SER A 55 ? ? -53.35 104.36 69 18 THR A 72 ? ? -92.58 -149.29 70 18 VAL A 100 ? ? -85.19 -70.78 71 19 PHE A 29 ? ? -140.88 -30.03 72 19 SER A 55 ? ? -51.69 102.37 73 19 THR A 72 ? ? -104.18 -144.88 74 19 VAL A 100 ? ? -92.82 -72.94 75 20 PHE A 29 ? ? -131.77 -41.90 76 20 CYS A 31 ? ? 39.51 73.64 77 20 ASN A 35 ? ? -164.53 114.89 78 20 THR A 72 ? ? -87.72 -146.95 79 20 VAL A 100 ? ? -95.81 -69.15 #