data_1PUQ # _entry.id 1PUQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PUQ pdb_00001puq 10.2210/pdb1puq/pdb RCSB RCSB019583 ? ? WWPDB D_1000019583 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-08-26 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-11-20 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_struct_assembly 2 4 'Structure model' pdbx_struct_assembly_prop 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 4 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 5 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PUQ _pdbx_database_status.recvd_initial_deposition_date 2003-06-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1PPX 'Solution structure of the same complex without assumed distances ligand/protein.' unspecified PDB 1MUT 'The free solution structure.' unspecified PDB 1TUM 'Complexed with AMPCPP-Mg.' unspecified PDB 1PUN ;Solution Structure of the MutT Pyrophosphohydrolase Complexed with Mg(2+) and 8-oxo-dGMP, a Tightly-bound Product ; unspecified PDB 1PUS ;Solution Structure of the MutT Pyrophosphohydrolase Complexed with Mg(2+) and 8-oxo-dGMP, a Tightly-bound Product ; unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Massiah, M.A.' 1 'Saraswat, V.' 2 'Azurmendi, H.F.' 3 'Mildvan, A.S.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution structure and NH exchange studies of the MutT pyrophosphohydrolase complexed with Mg(2+) and 8-oxo-dGMP, a tightly bound product. ; Biochemistry 42 10140 10154 2003 BICHAW US 0006-2960 0033 ? 12939141 10.1021/bi030105p 1 'Solution Structure of the Quaternary Complex MutT-M(2+)-AMPCPP-M(2+) Complex and Mechanism of its Pyrophosphohydrolase Action' Biochemistry 36 1199 1211 1997 BICHAW US 0006-2960 0033 ? ? 10.1021/bi962619c 2 'NMR Studies of the Conformations and Location of Nucleotides Bound to the E.Coli MutT Enzyme' Biochemistry 34 5577 5586 1995 BICHAW US 0006-2960 0033 ? ? ? 3 'Solution Structure of the MutT Enzyme, a Nucleoside Triphosphate Pyrophosphohydrolase' Biochemistry 34 14997 15005 1995 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Massiah, M.A.' 1 ? primary 'Saraswat, V.' 2 ? primary 'Azurmendi, H.F.' 3 ? primary 'Mildvan, A.S.' 4 ? 1 'Lin, J.' 5 ? 1 'Abeygunawardana, C.' 6 ? 1 'Frick, D.N.' 7 ? 1 'J Bessman, M.' 8 ? 1 'Mildvan, A.S.' 9 ? 2 'Frick, D.N.' 10 ? 2 'Weber, D.J.' 11 ? 2 'Abeygunawardana, C.' 12 ? 2 'Gittis, A.G.' 13 ? 2 'J Bessman, M.' 14 ? 2 'Mildvan, A.S.' 15 ? 3 'Abeygunawardana, C.' 16 ? 3 'Weber, D.J.' 17 ? 3 'Gittis, A.G.' 18 ? 3 'Frick, D.N.' 19 ? 3 'Lin, J.' 20 ? 3 'Miller, A.F.' 21 ? 3 'Bessman, M.J.' 22 ? 3 'Mildvan, A.S.' 23 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mutator mutT protein' 14945.029 1 3.6.1.- ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 363.221 1 ? ? ? ? 4 water nat water 18.015 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '7,8-dihydro-8-oxoguanine-triphosphatase, 8-oxo-dGTPase, dGTP pyrophosphohydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHI TLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL ; _entity_poly.pdbx_seq_one_letter_code_can ;MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHI TLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 8OG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LYS n 1 4 LEU n 1 5 GLN n 1 6 ILE n 1 7 ALA n 1 8 VAL n 1 9 GLY n 1 10 ILE n 1 11 ILE n 1 12 ARG n 1 13 ASN n 1 14 GLU n 1 15 ASN n 1 16 ASN n 1 17 GLU n 1 18 ILE n 1 19 PHE n 1 20 ILE n 1 21 THR n 1 22 ARG n 1 23 ARG n 1 24 ALA n 1 25 ALA n 1 26 ASP n 1 27 ALA n 1 28 HIS n 1 29 MET n 1 30 ALA n 1 31 ASN n 1 32 LYS n 1 33 LEU n 1 34 GLU n 1 35 PHE n 1 36 PRO n 1 37 GLY n 1 38 GLY n 1 39 LYS n 1 40 ILE n 1 41 GLU n 1 42 MET n 1 43 GLY n 1 44 GLU n 1 45 THR n 1 46 PRO n 1 47 GLU n 1 48 GLN n 1 49 ALA n 1 50 VAL n 1 51 VAL n 1 52 ARG n 1 53 GLU n 1 54 LEU n 1 55 GLN n 1 56 GLU n 1 57 GLU n 1 58 VAL n 1 59 GLY n 1 60 ILE n 1 61 THR n 1 62 PRO n 1 63 GLN n 1 64 HIS n 1 65 PHE n 1 66 SER n 1 67 LEU n 1 68 PHE n 1 69 GLU n 1 70 LYS n 1 71 LEU n 1 72 GLU n 1 73 TYR n 1 74 GLU n 1 75 PHE n 1 76 PRO n 1 77 ASP n 1 78 ARG n 1 79 HIS n 1 80 ILE n 1 81 THR n 1 82 LEU n 1 83 TRP n 1 84 PHE n 1 85 TRP n 1 86 LEU n 1 87 VAL n 1 88 GLU n 1 89 ARG n 1 90 TRP n 1 91 GLU n 1 92 GLY n 1 93 GLU n 1 94 PRO n 1 95 TRP n 1 96 GLY n 1 97 LYS n 1 98 GLU n 1 99 GLY n 1 100 GLN n 1 101 PRO n 1 102 GLY n 1 103 GLU n 1 104 TRP n 1 105 MET n 1 106 SER n 1 107 LEU n 1 108 VAL n 1 109 GLY n 1 110 LEU n 1 111 ASN n 1 112 ALA n 1 113 ASP n 1 114 ASP n 1 115 PHE n 1 116 PRO n 1 117 PRO n 1 118 ALA n 1 119 ASN n 1 120 GLU n 1 121 PRO n 1 122 VAL n 1 123 ILE n 1 124 ALA n 1 125 LYS n 1 126 LEU n 1 127 LYS n 1 128 ARG n 1 129 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene 'MUTT,STRAIN: K12-I7023' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HMS174 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET MUTT, T7 PROMOTER' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8OG 'DNA linking' n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 'C10 H14 N5 O8 P' 363.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 TRP 85 85 85 TRP TRP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 TRP 95 95 95 TRP TRP A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 TRP 104 104 104 TRP TRP A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 LEU 129 129 129 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 130 130 MG MO2 A . C 3 8OG 1 131 131 8OG 8OG A . D 4 HOH 1 5011 130 HOH MO2 A . D 4 HOH 2 5012 130 HOH MO2 A . D 4 HOH 3 5013 130 HOH MO2 A . D 4 HOH 4 5014 130 HOH MO2 A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A HOH 5013 ? O ? D HOH 3 O 2 1 N 1 A HOH 5014 ? O ? D HOH 4 O 3 2 N 1 A HOH 5025 ? O ? D HOH 3 O 4 2 N 1 A HOH 5026 ? O ? D HOH 4 O 5 3 N 1 A HOH 5037 ? O ? D HOH 3 O 6 3 N 1 A HOH 5038 ? O ? D HOH 4 O 7 4 N 1 A HOH 5049 ? O ? D HOH 3 O 8 4 N 1 A HOH 5050 ? O ? D HOH 4 O 9 5 N 1 A HOH 5061 ? O ? D HOH 3 O 10 5 N 1 A HOH 5062 ? O ? D HOH 4 O 11 6 N 1 A HOH 5073 ? O ? D HOH 3 O 12 6 N 1 A HOH 5074 ? O ? D HOH 4 O 13 7 N 1 A HOH 5085 ? O ? D HOH 3 O 14 7 N 1 A HOH 5086 ? O ? D HOH 4 O 15 8 N 1 A HOH 5097 ? O ? D HOH 3 O 16 8 N 1 A HOH 5098 ? O ? D HOH 4 O 17 9 N 1 A HOH 5109 ? O ? D HOH 3 O 18 9 N 1 A HOH 5110 ? O ? D HOH 4 O 19 10 N 1 A HOH 5121 ? O ? D HOH 3 O 20 10 N 1 A HOH 5122 ? O ? D HOH 4 O 21 11 N 1 A HOH 5133 ? O ? D HOH 3 O 22 11 N 1 A HOH 5134 ? O ? D HOH 4 O 23 12 N 1 A HOH 5145 ? O ? D HOH 3 O 24 12 N 1 A HOH 5146 ? O ? D HOH 4 O 25 13 N 1 A HOH 5157 ? O ? D HOH 3 O 26 13 N 1 A HOH 5158 ? O ? D HOH 4 O 27 14 N 1 A HOH 5169 ? O ? D HOH 3 O 28 14 N 1 A HOH 5170 ? O ? D HOH 4 O 29 15 N 1 A HOH 5181 ? O ? D HOH 3 O 30 15 N 1 A HOH 5182 ? O ? D HOH 4 O 31 16 N 1 A HOH 5193 ? O ? D HOH 3 O 32 16 N 1 A HOH 5194 ? O ? D HOH 4 O 33 17 N 1 A HOH 5205 ? O ? D HOH 3 O 34 17 N 1 A HOH 5206 ? O ? D HOH 4 O 35 18 N 1 A HOH 5217 ? O ? D HOH 3 O 36 18 N 1 A HOH 5218 ? O ? D HOH 4 O 37 19 N 1 A HOH 5229 ? O ? D HOH 3 O 38 19 N 1 A HOH 5230 ? O ? D HOH 4 O 39 20 N 1 A HOH 5241 ? O ? D HOH 3 O 40 20 N 1 A HOH 5242 ? O ? D HOH 4 O # _exptl.entry_id 1PUQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1PUQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1PUQ _struct.title 'Solution Structure of the MutT Pyrophosphohydrolase Complexed with Mg(2+) and 8-oxo-dGMP, a Tightly-bound Product' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PUQ _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'MUTATOR PROTEIN, NUCLEOSIDE TRIPHOSPHATE PYROPHOSPHOHYDROLASE, MUTT PYROPHOSPHOHYDROLASE-METAL-PRODUCT COMPLEX, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MUTT_ECOLI _struct_ref.pdbx_db_accession P08337 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHI TLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PUQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 129 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08337 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 129 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 129 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 670 ? 1 MORE -7 ? 1 'SSA (A^2)' 7620 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 39 ? GLU A 44 ? LYS A 39 GLU A 44 5 ? 6 HELX_P HELX_P2 2 GLU A 47 ? GLY A 59 ? GLU A 47 GLY A 59 1 ? 13 HELX_P HELX_P3 3 SER A 106 ? LEU A 110 ? SER A 106 LEU A 110 5 ? 5 HELX_P HELX_P4 4 PRO A 116 ? ALA A 118 ? PRO A 116 ALA A 118 5 ? 3 HELX_P HELX_P5 5 ASN A 119 ? ARG A 128 ? ASN A 119 ARG A 128 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLY 38 O ? ? ? 1_555 B MG . MG ? ? A GLY 38 A MG 130 1_555 ? ? ? ? ? ? ? 2.404 ? ? metalc2 metalc ? ? A GLU 53 OE2 ? ? ? 1_555 B MG . MG ? ? A GLU 53 A MG 130 1_555 ? ? ? ? ? ? ? 2.407 ? ? metalc3 metalc ? ? A GLU 56 OE1 ? ? ? 1_555 B MG . MG ? ? A GLU 56 A MG 130 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc4 metalc ? ? A GLU 57 OE1 ? ? ? 1_555 B MG . MG ? ? A GLU 57 A MG 130 1_555 ? ? ? ? ? ? ? 2.409 ? ? metalc5 metalc ? ? A GLU 57 OE2 ? ? ? 1_555 B MG . MG ? ? A GLU 57 A MG 130 1_555 ? ? ? ? ? ? ? 2.522 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 130 A HOH 5011 1_555 ? ? ? ? ? ? ? 2.112 ? ? metalc7 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 130 A HOH 5012 1_555 ? ? ? ? ? ? ? 2.110 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A GLY 38 ? A GLY 38 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 OE2 ? A GLU 53 ? A GLU 53 ? 1_555 81.6 ? 2 O ? A GLY 38 ? A GLY 38 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 OE1 ? A GLU 56 ? A GLU 56 ? 1_555 149.3 ? 3 OE2 ? A GLU 53 ? A GLU 53 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 OE1 ? A GLU 56 ? A GLU 56 ? 1_555 78.8 ? 4 O ? A GLY 38 ? A GLY 38 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 76.7 ? 5 OE2 ? A GLU 53 ? A GLU 53 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 87.7 ? 6 OE1 ? A GLU 56 ? A GLU 56 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 79.0 ? 7 O ? A GLY 38 ? A GLY 38 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 58.7 ? 8 OE2 ? A GLU 53 ? A GLU 53 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 127.5 ? 9 OE1 ? A GLU 56 ? A GLU 56 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 118.1 ? 10 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 52.9 ? 11 O ? A GLY 38 ? A GLY 38 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 O ? D HOH . ? A HOH 5011 ? 1_555 108.7 ? 12 OE2 ? A GLU 53 ? A GLU 53 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 O ? D HOH . ? A HOH 5011 ? 1_555 82.7 ? 13 OE1 ? A GLU 56 ? A GLU 56 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 O ? D HOH . ? A HOH 5011 ? 1_555 92.1 ? 14 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 O ? D HOH . ? A HOH 5011 ? 1_555 168.1 ? 15 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 O ? D HOH . ? A HOH 5011 ? 1_555 139.0 ? 16 O ? A GLY 38 ? A GLY 38 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 O ? D HOH . ? A HOH 5012 ? 1_555 116.0 ? 17 OE2 ? A GLU 53 ? A GLU 53 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 O ? D HOH . ? A HOH 5012 ? 1_555 162.3 ? 18 OE1 ? A GLU 56 ? A GLU 56 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 O ? D HOH . ? A HOH 5012 ? 1_555 85.7 ? 19 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 O ? D HOH . ? A HOH 5012 ? 1_555 97.7 ? 20 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 O ? D HOH . ? A HOH 5012 ? 1_555 67.7 ? 21 O ? D HOH . ? A HOH 5011 ? 1_555 MG ? B MG . ? A MG 130 ? 1_555 O ? D HOH . ? A HOH 5012 ? 1_555 89.5 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 64 ? TYR A 73 ? HIS A 64 TYR A 73 A 2 HIS A 79 ? VAL A 87 ? HIS A 79 VAL A 87 A 3 LYS A 3 ? ARG A 12 ? LYS A 3 ARG A 12 A 4 ILE A 18 ? THR A 21 ? ILE A 18 THR A 21 A 5 GLY A 102 ? MET A 105 ? GLY A 102 MET A 105 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 71 ? N LEU A 71 O LEU A 82 ? O LEU A 82 A 2 3 O TRP A 83 ? O TRP A 83 N VAL A 8 ? N VAL A 8 A 3 4 N ILE A 11 ? N ILE A 11 O PHE A 19 ? O PHE A 19 A 4 5 N ILE A 18 ? N ILE A 18 O MET A 105 ? O MET A 105 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 130 ? 7 'BINDING SITE FOR RESIDUE MG A 130' AC2 Software A 8OG 131 ? 8 'BINDING SITE FOR RESIDUE 8OG A 131' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 GLY A 38 ? GLY A 38 . ? 1_555 ? 2 AC1 7 LYS A 39 ? LYS A 39 . ? 1_555 ? 3 AC1 7 GLU A 53 ? GLU A 53 . ? 1_555 ? 4 AC1 7 GLU A 56 ? GLU A 56 . ? 1_555 ? 5 AC1 7 GLU A 57 ? GLU A 57 . ? 1_555 ? 6 AC1 7 HOH D . ? HOH A 5011 . ? 1_555 ? 7 AC1 7 HOH D . ? HOH A 5012 . ? 1_555 ? 8 AC2 8 LEU A 4 ? LEU A 4 . ? 1_555 ? 9 AC2 8 ILE A 6 ? ILE A 6 . ? 1_555 ? 10 AC2 8 GLU A 34 ? GLU A 34 . ? 1_555 ? 11 AC2 8 PHE A 75 ? PHE A 75 . ? 1_555 ? 12 AC2 8 ARG A 78 ? ARG A 78 . ? 1_555 ? 13 AC2 8 ILE A 80 ? ILE A 80 . ? 1_555 ? 14 AC2 8 ALA A 118 ? ALA A 118 . ? 1_555 ? 15 AC2 8 ASN A 119 ? ASN A 119 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 5012 ? ? H2 A HOH 5013 ? ? 0.96 2 1 O A HOH 5011 ? ? H1 A HOH 5014 ? ? 0.96 3 1 O A HOH 5011 ? ? H1 A HOH 5013 ? ? 0.96 4 1 O A HOH 5012 ? ? H2 A HOH 5014 ? ? 0.96 5 1 O A GLU 120 ? ? H A ALA 124 ? ? 1.54 6 1 O A ILE 123 ? ? H A LYS 127 ? ? 1.57 7 1 O A PHE 75 ? ? H A ARG 78 ? ? 1.58 8 1 O A THR 45 ? ? H A ALA 49 ? ? 1.60 9 2 O A HOH 5023 ? ? H1 A HOH 5025 ? ? 0.96 10 2 O A HOH 5024 ? ? H2 A HOH 5025 ? ? 0.96 11 2 O A HOH 5023 ? ? H1 A HOH 5026 ? ? 0.96 12 2 O A HOH 5024 ? ? H2 A HOH 5026 ? ? 0.96 13 2 O A GLU 120 ? ? H A ALA 124 ? ? 1.53 14 2 H A ASN 13 ? ? O A GLU 17 ? ? 1.57 15 3 O A HOH 5035 ? ? H1 A HOH 5038 ? ? 0.96 16 3 O A HOH 5036 ? ? H2 A HOH 5038 ? ? 0.96 17 3 O A HOH 5035 ? ? H1 A HOH 5037 ? ? 0.96 18 3 O A HOH 5036 ? ? H2 A HOH 5037 ? ? 0.96 19 3 O A ILE 123 ? ? H A LYS 127 ? ? 1.56 20 3 O A GLU 120 ? ? H A ALA 124 ? ? 1.56 21 3 H A ASN 13 ? ? O A GLU 17 ? ? 1.59 22 4 O A HOH 5047 ? ? H1 A HOH 5050 ? ? 0.96 23 4 O A HOH 5048 ? ? H2 A HOH 5050 ? ? 0.96 24 4 O A HOH 5048 ? ? H2 A HOH 5049 ? ? 0.96 25 4 O A HOH 5047 ? ? H1 A HOH 5049 ? ? 0.96 26 4 H A ASN 13 ? ? O A GLU 17 ? ? 1.51 27 4 O A GLU 120 ? ? H A ALA 124 ? ? 1.58 28 5 O A HOH 5060 ? ? H2 A HOH 5062 ? ? 0.96 29 5 O A HOH 5059 ? ? H1 A HOH 5061 ? ? 0.96 30 5 O A HOH 5060 ? ? H2 A HOH 5061 ? ? 0.96 31 5 O A HOH 5059 ? ? H1 A HOH 5062 ? ? 0.96 32 5 O A ILE 123 ? ? H A LYS 127 ? ? 1.56 33 5 O A GLU 120 ? ? H A ALA 124 ? ? 1.58 34 6 O A HOH 5072 ? ? H2 A HOH 5074 ? ? 0.96 35 6 O A HOH 5071 ? ? H1 A HOH 5074 ? ? 0.96 36 6 O A HOH 5071 ? ? H1 A HOH 5073 ? ? 0.96 37 6 O A HOH 5072 ? ? H2 A HOH 5073 ? ? 0.96 38 6 O A GLU 120 ? ? H A ALA 124 ? ? 1.54 39 6 H A ASN 13 ? ? O A GLU 17 ? ? 1.56 40 6 O A ILE 123 ? ? H A LYS 127 ? ? 1.58 41 7 O A HOH 5084 ? ? H2 A HOH 5086 ? ? 0.96 42 7 O A HOH 5083 ? ? H1 A HOH 5086 ? ? 0.96 43 7 O A HOH 5083 ? ? H1 A HOH 5085 ? ? 0.96 44 7 O A HOH 5084 ? ? H2 A HOH 5085 ? ? 0.96 45 7 O A GLU 120 ? ? H A ALA 124 ? ? 1.58 46 7 O A ILE 123 ? ? H A LYS 127 ? ? 1.58 47 8 O A HOH 5095 ? ? H1 A HOH 5098 ? ? 0.96 48 8 O A HOH 5096 ? ? H2 A HOH 5097 ? ? 0.96 49 8 O A HOH 5096 ? ? H2 A HOH 5098 ? ? 0.96 50 8 O A HOH 5095 ? ? H1 A HOH 5097 ? ? 0.96 51 8 O A GLU 120 ? ? H A ALA 124 ? ? 1.55 52 8 H A ASN 13 ? ? O A GLU 17 ? ? 1.58 53 8 O A VAL 8 ? ? H A TRP 85 ? ? 1.59 54 9 O A HOH 5107 ? ? H1 A HOH 5110 ? ? 0.96 55 9 O A HOH 5108 ? ? H2 A HOH 5109 ? ? 0.96 56 9 O A HOH 5108 ? ? H2 A HOH 5110 ? ? 0.96 57 9 O A HOH 5107 ? ? H1 A HOH 5109 ? ? 0.96 58 9 O A ILE 123 ? ? H A LYS 127 ? ? 1.55 59 9 O A THR 45 ? ? H A ALA 49 ? ? 1.56 60 9 H A ASN 13 ? ? O A GLU 17 ? ? 1.57 61 9 O A GLU 120 ? ? H A ALA 124 ? ? 1.58 62 9 H A LEU 4 ? ? O A HIS 79 ? ? 1.58 63 9 H A PHE 75 ? ? O A ARG 78 ? ? 1.60 64 10 O A HOH 5120 ? ? H2 A HOH 5121 ? ? 0.96 65 10 O A HOH 5120 ? ? H2 A HOH 5122 ? ? 0.96 66 10 O A HOH 5119 ? ? H1 A HOH 5122 ? ? 0.96 67 10 O A HOH 5119 ? ? H1 A HOH 5121 ? ? 0.96 68 10 O A GLU 120 ? ? H A ALA 124 ? ? 1.54 69 10 O A THR 45 ? ? H A ALA 49 ? ? 1.56 70 10 O A ILE 123 ? ? H A LYS 127 ? ? 1.56 71 10 H A ASN 13 ? ? O A GLU 17 ? ? 1.59 72 11 O A HOH 5131 ? ? H1 A HOH 5133 ? ? 0.96 73 11 O A HOH 5132 ? ? H2 A HOH 5133 ? ? 0.96 74 11 O A HOH 5131 ? ? H1 A HOH 5134 ? ? 0.96 75 11 O A HOH 5132 ? ? H2 A HOH 5134 ? ? 0.96 76 11 O A ILE 123 ? ? H A LYS 127 ? ? 1.54 77 11 O A GLU 120 ? ? H A ALA 124 ? ? 1.55 78 11 H A ASN 13 ? ? O A GLU 17 ? ? 1.55 79 12 O A HOH 5143 ? ? H1 A HOH 5145 ? ? 0.96 80 12 O A HOH 5143 ? ? H1 A HOH 5146 ? ? 0.96 81 12 O A HOH 5144 ? ? H2 A HOH 5145 ? ? 0.96 82 12 O A HOH 5144 ? ? H2 A HOH 5146 ? ? 0.96 83 12 O A GLU 120 ? ? H A ALA 124 ? ? 1.56 84 13 O A HOH 5155 ? ? H1 A HOH 5158 ? ? 0.96 85 13 O A HOH 5156 ? ? H2 A HOH 5157 ? ? 0.96 86 13 O A HOH 5156 ? ? H2 A HOH 5158 ? ? 0.96 87 13 O A HOH 5155 ? ? H1 A HOH 5157 ? ? 0.96 88 13 O A GLU 120 ? ? H A ALA 124 ? ? 1.58 89 13 H A ASN 13 ? ? O A GLU 17 ? ? 1.60 90 14 O A HOH 5167 ? ? H1 A HOH 5169 ? ? 0.96 91 14 O A HOH 5168 ? ? H2 A HOH 5170 ? ? 0.96 92 14 O A HOH 5167 ? ? H1 A HOH 5170 ? ? 0.96 93 14 O A HOH 5168 ? ? H2 A HOH 5169 ? ? 0.96 94 14 O A VAL 8 ? ? H A TRP 85 ? ? 1.54 95 14 O A ILE 123 ? ? H A LYS 127 ? ? 1.56 96 14 O A GLU 120 ? ? H A ALA 124 ? ? 1.58 97 14 H A ASN 13 ? ? O A GLU 17 ? ? 1.59 98 14 H A VAL 8 ? ? O A TRP 83 ? ? 1.59 99 15 O A HOH 5179 ? ? H1 A HOH 5181 ? ? 0.96 100 15 O A HOH 5180 ? ? H2 A HOH 5181 ? ? 0.96 101 15 O A HOH 5180 ? ? H2 A HOH 5182 ? ? 0.96 102 15 O A HOH 5179 ? ? H1 A HOH 5182 ? ? 0.96 103 15 HB3 A LYS 39 ? ? MG A MG 130 ? ? 1.55 104 15 O A GLU 120 ? ? H A ALA 124 ? ? 1.55 105 16 O A HOH 5192 ? ? H2 A HOH 5194 ? ? 0.96 106 16 O A HOH 5191 ? ? H1 A HOH 5193 ? ? 0.96 107 16 O A HOH 5192 ? ? H2 A HOH 5193 ? ? 0.96 108 16 O A HOH 5191 ? ? H1 A HOH 5194 ? ? 0.96 109 16 O A GLU 120 ? ? H A ALA 124 ? ? 1.55 110 16 O A VAL 8 ? ? H A TRP 85 ? ? 1.58 111 16 O A ILE 123 ? ? H A LYS 127 ? ? 1.59 112 17 O A HOH 5203 ? ? H1 A HOH 5205 ? ? 0.96 113 17 O A HOH 5204 ? ? H2 A HOH 5206 ? ? 0.96 114 17 O A HOH 5203 ? ? H1 A HOH 5206 ? ? 0.96 115 17 O A HOH 5204 ? ? H2 A HOH 5205 ? ? 0.96 116 17 O A GLU 120 ? ? H A ALA 124 ? ? 1.55 117 17 O A THR 45 ? ? H A ALA 49 ? ? 1.57 118 18 O A HOH 5216 ? ? H2 A HOH 5217 ? ? 0.96 119 18 O A HOH 5215 ? ? H1 A HOH 5218 ? ? 0.96 120 18 O A HOH 5216 ? ? H2 A HOH 5218 ? ? 0.96 121 18 O A HOH 5215 ? ? H1 A HOH 5217 ? ? 0.96 122 18 O A VAL 8 ? ? H A TRP 85 ? ? 1.55 123 18 H A ASN 13 ? ? O A GLU 17 ? ? 1.55 124 18 O A ILE 123 ? ? H A LYS 127 ? ? 1.59 125 19 O A HOH 5227 ? ? H1 A HOH 5229 ? ? 0.96 126 19 O A HOH 5227 ? ? H1 A HOH 5230 ? ? 0.96 127 19 O A HOH 5228 ? ? H2 A HOH 5229 ? ? 0.96 128 19 O A HOH 5228 ? ? H2 A HOH 5230 ? ? 0.96 129 19 O A VAL 8 ? ? H A TRP 85 ? ? 1.54 130 19 O A GLU 120 ? ? H A ALA 124 ? ? 1.55 131 19 O A THR 45 ? ? H A ALA 49 ? ? 1.57 132 19 O A ILE 123 ? ? H A LYS 127 ? ? 1.58 133 19 O A PHE 75 ? ? H A ARG 78 ? ? 1.58 134 20 O A HOH 5240 ? ? H2 A HOH 5241 ? ? 0.96 135 20 O A HOH 5239 ? ? H1 A HOH 5242 ? ? 0.96 136 20 O A HOH 5240 ? ? H2 A HOH 5242 ? ? 0.96 137 20 O A HOH 5239 ? ? H1 A HOH 5241 ? ? 0.96 138 20 H A ASN 13 ? ? O A GLU 17 ? ? 1.54 139 20 O A GLU 120 ? ? H A ALA 124 ? ? 1.55 140 20 O A ILE 123 ? ? H A LYS 127 ? ? 1.58 141 20 O A ILE 6 ? ? H A TRP 83 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 16 ? ? 45.78 24.32 2 1 ARG A 23 ? ? 47.71 26.15 3 1 ALA A 24 ? ? 46.60 -168.78 4 1 ASP A 26 ? ? -162.33 33.62 5 1 MET A 29 ? ? -60.34 86.57 6 1 ASN A 31 ? ? -96.37 31.17 7 1 LEU A 33 ? ? -63.11 74.67 8 1 LYS A 39 ? ? 86.11 -2.19 9 1 MET A 42 ? ? 9.64 -81.10 10 1 VAL A 58 ? ? -134.29 -45.11 11 1 PHE A 65 ? ? 179.77 166.91 12 1 SER A 66 ? ? 87.31 155.39 13 1 GLU A 69 ? ? -171.77 144.42 14 1 PRO A 76 ? ? -50.72 83.79 15 1 ASP A 77 ? ? 93.98 15.45 16 1 TRP A 95 ? ? -121.23 -62.62 17 1 LYS A 97 ? ? 173.59 39.43 18 2 ASN A 16 ? ? 47.56 21.17 19 2 ARG A 23 ? ? 47.71 -109.75 20 2 ALA A 24 ? ? 168.40 -170.71 21 2 ASP A 26 ? ? -132.80 -45.94 22 2 ALA A 27 ? ? -71.75 -166.11 23 2 HIS A 28 ? ? -95.62 -86.54 24 2 MET A 29 ? ? 46.47 29.09 25 2 LEU A 33 ? ? -64.01 74.76 26 2 LYS A 39 ? ? 82.29 0.25 27 2 MET A 42 ? ? 8.05 -80.27 28 2 VAL A 58 ? ? -133.18 -44.01 29 2 PHE A 65 ? ? -179.82 -133.55 30 2 SER A 66 ? ? 55.23 167.72 31 2 PRO A 76 ? ? -50.81 81.91 32 2 ASP A 77 ? ? 89.58 12.88 33 2 TRP A 95 ? ? -126.24 -64.70 34 2 LYS A 97 ? ? 170.99 37.67 35 3 ARG A 23 ? ? 50.33 -103.18 36 3 ALA A 24 ? ? 179.71 -67.62 37 3 ALA A 25 ? ? -175.64 -40.49 38 3 ALA A 27 ? ? 63.67 158.23 39 3 MET A 29 ? ? -142.75 41.09 40 3 GLU A 34 ? ? -106.73 -167.71 41 3 LYS A 39 ? ? 84.53 -0.18 42 3 MET A 42 ? ? 0.90 -75.33 43 3 VAL A 58 ? ? -133.81 -44.04 44 3 ILE A 60 ? ? -114.37 -166.80 45 3 PHE A 65 ? ? 179.78 163.61 46 3 SER A 66 ? ? 85.64 154.57 47 3 GLU A 69 ? ? -171.87 138.26 48 3 PRO A 76 ? ? -55.63 81.73 49 3 ASP A 77 ? ? 97.08 6.00 50 3 TRP A 95 ? ? -132.25 -59.75 51 3 LYS A 97 ? ? 174.77 39.63 52 4 ASN A 15 ? ? -141.36 52.24 53 4 ASN A 16 ? ? 44.71 25.79 54 4 ARG A 23 ? ? 50.77 -106.76 55 4 ALA A 24 ? ? 173.45 37.74 56 4 ASP A 26 ? ? 176.62 162.55 57 4 ALA A 27 ? ? 62.49 -166.26 58 4 MET A 29 ? ? -171.23 34.37 59 4 LEU A 33 ? ? -58.07 86.36 60 4 LYS A 39 ? ? 107.92 2.51 61 4 MET A 42 ? ? 22.43 -86.18 62 4 VAL A 58 ? ? -134.85 -44.50 63 4 PHE A 65 ? ? -176.59 -39.34 64 4 SER A 66 ? ? -40.74 160.87 65 4 GLU A 69 ? ? -172.03 144.08 66 4 PRO A 76 ? ? -53.60 82.50 67 4 ASP A 77 ? ? 100.43 11.51 68 4 TRP A 95 ? ? -133.40 -58.91 69 4 LYS A 97 ? ? 176.80 36.38 70 5 ASN A 16 ? ? 45.88 25.19 71 5 ARG A 23 ? ? 53.40 -111.45 72 5 ALA A 24 ? ? 173.13 -167.96 73 5 ASP A 26 ? ? -179.64 -41.54 74 5 ALA A 27 ? ? -73.93 -169.05 75 5 MET A 29 ? ? -155.35 60.05 76 5 LEU A 33 ? ? -67.93 63.20 77 5 GLU A 34 ? ? -109.42 -166.93 78 5 LYS A 39 ? ? 91.60 -0.98 79 5 MET A 42 ? ? 0.40 -75.03 80 5 VAL A 58 ? ? -133.41 -44.09 81 5 PHE A 65 ? ? -177.08 -133.57 82 5 SER A 66 ? ? 54.51 171.49 83 5 GLU A 69 ? ? -171.79 142.72 84 5 PRO A 76 ? ? -52.74 82.91 85 5 ASP A 77 ? ? 91.32 9.68 86 5 TRP A 95 ? ? -135.06 -62.80 87 5 LYS A 97 ? ? 172.31 38.64 88 6 ASN A 15 ? ? -122.49 -82.64 89 6 ASN A 16 ? ? -154.58 13.81 90 6 ALA A 24 ? ? 46.23 28.69 91 6 ALA A 25 ? ? 81.89 -47.09 92 6 ASP A 26 ? ? 177.32 82.01 93 6 ALA A 27 ? ? -135.22 -79.33 94 6 HIS A 28 ? ? -166.21 -55.88 95 6 MET A 29 ? ? -63.37 81.90 96 6 ASN A 31 ? ? -97.00 31.13 97 6 LEU A 33 ? ? -65.67 69.77 98 6 GLU A 34 ? ? -119.82 -166.97 99 6 LYS A 39 ? ? 88.17 0.34 100 6 MET A 42 ? ? 4.23 -78.42 101 6 VAL A 58 ? ? -134.61 -44.20 102 6 PHE A 65 ? ? -175.65 -145.44 103 6 SER A 66 ? ? 51.96 172.18 104 6 GLU A 69 ? ? -171.68 131.90 105 6 PRO A 76 ? ? -53.18 82.52 106 6 ASP A 77 ? ? 92.50 8.69 107 6 TRP A 95 ? ? -132.06 -62.08 108 6 LYS A 97 ? ? 179.33 35.70 109 7 ASN A 16 ? ? 58.56 13.78 110 7 ARG A 23 ? ? 48.87 -102.15 111 7 ALA A 24 ? ? 177.73 -177.42 112 7 ASP A 26 ? ? -170.02 -54.00 113 7 ALA A 27 ? ? -178.86 132.40 114 7 HIS A 28 ? ? 179.60 -169.01 115 7 ASN A 31 ? ? -97.01 30.59 116 7 LEU A 33 ? ? -61.24 77.33 117 7 LYS A 39 ? ? 84.84 1.62 118 7 MET A 42 ? ? 5.86 -80.02 119 7 VAL A 58 ? ? -134.45 -44.33 120 7 PHE A 65 ? ? -176.31 -40.67 121 7 SER A 66 ? ? -41.40 163.57 122 7 PRO A 76 ? ? -56.41 81.50 123 7 ASP A 77 ? ? 99.45 3.84 124 7 TRP A 95 ? ? -130.42 -61.26 125 7 LYS A 97 ? ? 175.58 40.23 126 8 ASN A 16 ? ? 44.85 27.36 127 8 ARG A 23 ? ? 53.08 -102.51 128 8 ALA A 24 ? ? 174.45 -68.71 129 8 ALA A 25 ? ? -170.59 -42.11 130 8 ASP A 26 ? ? -160.79 38.83 131 8 HIS A 28 ? ? -59.22 87.34 132 8 MET A 29 ? ? -155.08 28.42 133 8 LEU A 33 ? ? -55.71 86.23 134 8 LYS A 39 ? ? 96.27 3.41 135 8 GLU A 41 ? ? -40.09 -76.53 136 8 MET A 42 ? ? 24.77 -85.48 137 8 VAL A 58 ? ? -133.41 -44.56 138 8 PHE A 65 ? ? -173.98 -49.77 139 8 SER A 66 ? ? -38.16 159.64 140 8 GLU A 69 ? ? -171.74 142.19 141 8 PRO A 76 ? ? -37.38 -29.10 142 8 ASP A 77 ? ? -139.62 -39.66 143 8 TRP A 95 ? ? -134.43 -64.32 144 8 LYS A 97 ? ? 173.44 38.83 145 9 ASN A 16 ? ? 46.71 24.42 146 9 ARG A 23 ? ? 48.01 -104.35 147 9 ALA A 24 ? ? 175.07 -166.93 148 9 ASP A 26 ? ? -166.17 81.23 149 9 MET A 29 ? ? -97.96 50.23 150 9 ASN A 31 ? ? -92.61 31.25 151 9 GLU A 34 ? ? -106.86 -169.27 152 9 LYS A 39 ? ? 101.58 -2.47 153 9 MET A 42 ? ? 23.54 -86.67 154 9 VAL A 58 ? ? -134.61 -44.70 155 9 PHE A 65 ? ? 179.60 163.50 156 9 SER A 66 ? ? 84.64 163.62 157 9 GLU A 69 ? ? -171.43 131.78 158 9 PRO A 76 ? ? -52.61 81.44 159 9 ASP A 77 ? ? 93.14 10.30 160 9 TRP A 95 ? ? -130.22 -63.47 161 9 LYS A 97 ? ? 168.55 41.95 162 10 ASN A 16 ? ? 48.96 23.13 163 10 ARG A 23 ? ? 48.82 -95.79 164 10 ALA A 24 ? ? 179.57 -38.70 165 10 ALA A 25 ? ? -169.49 -52.02 166 10 ASP A 26 ? ? -169.24 -49.09 167 10 HIS A 28 ? ? -169.09 -164.49 168 10 MET A 29 ? ? -65.15 77.83 169 10 LEU A 33 ? ? -64.77 73.23 170 10 LYS A 39 ? ? 106.36 1.19 171 10 MET A 42 ? ? 2.68 -78.02 172 10 VAL A 58 ? ? -134.42 -43.63 173 10 PHE A 65 ? ? -179.10 -134.12 174 10 SER A 66 ? ? 55.77 166.34 175 10 PRO A 76 ? ? -38.06 -29.14 176 10 ASP A 77 ? ? -139.63 -38.43 177 10 TRP A 95 ? ? -134.59 -63.45 178 10 LYS A 97 ? ? 168.22 40.22 179 11 ASN A 15 ? ? -143.25 51.89 180 11 ASN A 16 ? ? 44.17 27.62 181 11 ARG A 23 ? ? 47.22 -103.90 182 11 ALA A 24 ? ? 170.54 -166.36 183 11 ASP A 26 ? ? -148.18 33.40 184 11 MET A 29 ? ? -116.03 68.46 185 11 ASN A 31 ? ? -97.29 31.09 186 11 LEU A 33 ? ? -68.68 71.72 187 11 GLU A 34 ? ? -109.43 -167.21 188 11 LYS A 39 ? ? 86.00 0.51 189 11 MET A 42 ? ? 6.96 -79.35 190 11 VAL A 58 ? ? -133.39 -44.88 191 11 PHE A 65 ? ? -178.94 -136.84 192 11 SER A 66 ? ? 54.08 165.15 193 11 PRO A 76 ? ? -53.86 82.82 194 11 ASP A 77 ? ? 92.96 8.81 195 11 TRP A 95 ? ? -132.86 -61.08 196 11 LYS A 97 ? ? 175.24 37.91 197 12 ASN A 16 ? ? 47.54 24.53 198 12 ARG A 23 ? ? 56.15 -100.70 199 12 ALA A 24 ? ? -179.21 -167.73 200 12 ALA A 27 ? ? -59.96 -179.14 201 12 LEU A 33 ? ? -69.01 69.51 202 12 LYS A 39 ? ? 81.93 2.13 203 12 MET A 42 ? ? 2.93 -78.14 204 12 VAL A 58 ? ? -133.80 -44.07 205 12 PHE A 65 ? ? -176.85 -140.93 206 12 SER A 66 ? ? 50.78 175.98 207 12 GLU A 69 ? ? -171.65 131.82 208 12 PRO A 76 ? ? -53.65 81.93 209 12 ASP A 77 ? ? 93.76 8.60 210 12 TRP A 95 ? ? -123.07 -65.70 211 12 LYS A 97 ? ? 177.57 35.96 212 13 ASN A 16 ? ? 45.76 24.64 213 13 ARG A 23 ? ? 61.30 -112.49 214 13 ALA A 24 ? ? 171.67 -166.89 215 13 ASP A 26 ? ? -146.52 -80.23 216 13 ALA A 27 ? ? -179.41 -65.69 217 13 HIS A 28 ? ? -57.50 176.88 218 13 LEU A 33 ? ? -67.25 70.33 219 13 LYS A 39 ? ? 84.82 7.07 220 13 MET A 42 ? ? 5.80 -81.28 221 13 VAL A 58 ? ? -134.69 -44.11 222 13 PHE A 65 ? ? 179.97 -140.81 223 13 SER A 66 ? ? 50.33 176.43 224 13 GLU A 69 ? ? -171.83 131.80 225 13 PRO A 76 ? ? -51.87 82.79 226 13 ASP A 77 ? ? 89.56 11.16 227 13 LYS A 97 ? ? 174.08 40.19 228 14 ASN A 15 ? ? -140.19 52.34 229 14 ASN A 16 ? ? 45.96 24.35 230 14 ARG A 23 ? ? 56.52 -113.61 231 14 ALA A 24 ? ? -177.55 36.80 232 14 ALA A 27 ? ? -56.36 90.57 233 14 HIS A 28 ? ? -167.76 90.95 234 14 MET A 29 ? ? 61.19 70.97 235 14 ASN A 31 ? ? -96.35 31.06 236 14 LEU A 33 ? ? -62.77 84.38 237 14 GLU A 34 ? ? -126.13 -165.92 238 14 LYS A 39 ? ? 91.76 3.53 239 14 MET A 42 ? ? 17.94 -83.78 240 14 VAL A 58 ? ? -134.38 -44.89 241 14 PHE A 65 ? ? 178.52 160.88 242 14 SER A 66 ? ? 88.62 -165.64 243 14 GLU A 69 ? ? -171.12 131.46 244 14 PRO A 76 ? ? -38.68 -28.62 245 14 ASP A 77 ? ? -139.77 -38.04 246 14 TRP A 95 ? ? -124.91 -61.57 247 14 LYS A 97 ? ? 179.29 50.01 248 15 ASN A 15 ? ? -140.58 52.15 249 15 ASN A 16 ? ? 46.26 23.23 250 15 ARG A 23 ? ? 45.24 -107.42 251 15 ALA A 24 ? ? 172.86 -52.49 252 15 ALA A 25 ? ? -175.98 -40.43 253 15 ASP A 26 ? ? -172.77 100.26 254 15 ALA A 27 ? ? 61.99 110.22 255 15 HIS A 28 ? ? -177.37 -70.40 256 15 MET A 29 ? ? -150.40 67.10 257 15 LYS A 39 ? ? 108.97 2.31 258 15 GLU A 41 ? ? -38.16 -77.61 259 15 MET A 42 ? ? 33.80 -85.27 260 15 VAL A 58 ? ? -134.07 -44.88 261 15 PHE A 65 ? ? 178.71 -135.52 262 15 SER A 66 ? ? 55.94 166.49 263 15 PRO A 76 ? ? -50.30 81.37 264 15 ASP A 77 ? ? 91.15 13.32 265 15 LYS A 97 ? ? 172.28 37.36 266 16 ASN A 16 ? ? 46.34 24.58 267 16 ARG A 23 ? ? 51.74 -113.26 268 16 ALA A 24 ? ? 166.27 -176.44 269 16 ALA A 27 ? ? 58.88 -159.66 270 16 HIS A 28 ? ? -104.52 -84.20 271 16 MET A 29 ? ? 47.60 29.29 272 16 LEU A 33 ? ? -67.48 76.05 273 16 GLU A 34 ? ? -118.88 -169.00 274 16 LYS A 39 ? ? 89.62 9.91 275 16 GLU A 41 ? ? -37.04 -77.92 276 16 MET A 42 ? ? 36.05 -87.85 277 16 VAL A 58 ? ? -133.49 -44.28 278 16 PHE A 65 ? ? 179.83 -142.83 279 16 SER A 66 ? ? 50.82 175.98 280 16 GLU A 69 ? ? -171.73 131.64 281 16 PRO A 76 ? ? -39.28 -27.76 282 16 ASP A 77 ? ? -139.78 -37.08 283 16 TRP A 95 ? ? -133.49 -65.76 284 16 LYS A 97 ? ? 173.36 36.47 285 17 ASN A 16 ? ? 53.97 15.94 286 17 ARG A 23 ? ? 48.97 -106.74 287 17 ALA A 24 ? ? 168.44 -167.37 288 17 ASP A 26 ? ? 179.55 164.09 289 17 ALA A 27 ? ? 58.54 -168.10 290 17 HIS A 28 ? ? -96.75 -99.79 291 17 LEU A 33 ? ? -67.19 66.17 292 17 LYS A 39 ? ? 82.67 1.50 293 17 MET A 42 ? ? 11.07 -81.66 294 17 VAL A 58 ? ? -134.16 -44.26 295 17 PHE A 65 ? ? 179.91 166.02 296 17 SER A 66 ? ? 82.92 152.18 297 17 GLU A 69 ? ? -171.93 131.68 298 17 PRO A 76 ? ? -54.18 82.11 299 17 ASP A 77 ? ? 94.84 7.07 300 17 TRP A 95 ? ? -132.34 -59.91 301 17 LYS A 97 ? ? 178.43 38.80 302 18 ALA A 24 ? ? 80.42 3.00 303 18 HIS A 28 ? ? -97.71 -68.85 304 18 GLU A 34 ? ? -114.52 -166.63 305 18 LYS A 39 ? ? 93.75 -1.06 306 18 MET A 42 ? ? 12.24 -83.68 307 18 VAL A 58 ? ? -134.87 -44.85 308 18 SER A 66 ? ? 78.01 -168.39 309 18 GLU A 69 ? ? -171.76 131.45 310 18 PRO A 76 ? ? -53.18 81.95 311 18 ASP A 77 ? ? 93.40 8.61 312 18 LYS A 97 ? ? 171.61 74.61 313 19 ASN A 16 ? ? 53.03 19.58 314 19 ARG A 23 ? ? 52.44 -110.41 315 19 ALA A 24 ? ? 173.40 -170.63 316 19 ASP A 26 ? ? -171.41 35.33 317 19 MET A 29 ? ? -142.12 29.99 318 19 LEU A 33 ? ? -61.64 79.26 319 19 LYS A 39 ? ? 92.06 2.01 320 19 MET A 42 ? ? 10.28 -81.64 321 19 VAL A 58 ? ? -133.91 -43.87 322 19 PHE A 65 ? ? -177.85 -138.57 323 19 SER A 66 ? ? 51.01 173.73 324 19 GLU A 69 ? ? -172.27 131.70 325 19 PRO A 76 ? ? -51.69 83.48 326 19 ASP A 77 ? ? 97.14 14.39 327 19 TRP A 95 ? ? -150.27 -62.81 328 19 LYS A 97 ? ? -178.70 32.72 329 20 ASN A 15 ? ? -144.76 43.97 330 20 ASN A 16 ? ? 54.13 17.82 331 20 ARG A 23 ? ? 55.21 -92.61 332 20 ALA A 24 ? ? 173.71 -32.35 333 20 ASP A 26 ? ? 178.93 37.24 334 20 ALA A 27 ? ? 179.60 -166.58 335 20 MET A 29 ? ? 64.30 61.14 336 20 LEU A 33 ? ? -68.97 67.22 337 20 GLU A 34 ? ? -107.53 -167.77 338 20 LYS A 39 ? ? 82.74 1.58 339 20 MET A 42 ? ? 11.15 -84.00 340 20 VAL A 58 ? ? -133.38 -44.30 341 20 ILE A 60 ? ? -127.08 -167.46 342 20 PHE A 65 ? ? -176.43 -56.19 343 20 SER A 66 ? ? -33.57 157.05 344 20 PRO A 76 ? ? -54.99 81.93 345 20 ASP A 77 ? ? 96.25 6.52 346 20 TRP A 95 ? ? -129.72 -61.35 347 20 LYS A 97 ? ? 168.24 69.34 348 20 TRP A 104 ? ? -59.38 106.86 # _pdbx_nmr_ensemble.entry_id 1PUQ _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1PUQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1MM MUTT, 1.3MM 8-OXO-DGMP, 15MM MGCL2, 4MM D11-TRIS-HCL, PH 7.5, 21MM NACL, 0.34MM NAN3. ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '21 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 '2D NOESY' 3 1 1 '2D TOCSY' 4 1 1 3D_13C-separated_NOESY 5 1 1 12C/13C-filtered-NOESY-HSQC 6 1 1 HNCA 7 1 1 NHCACB # _pdbx_nmr_refine.entry_id 1PUQ _pdbx_nmr_refine.method 'simulated annealing torsion angle dynamics' _pdbx_nmr_refine.details ;the structures are based on 1746 NOE-derived distance constraints, 186 dihedral angle restraints derived from TALOS, 82 distance restraints from hydrogen bonds and 3 assumed distances ligand/protein (see Case 3, Table 1 in reference). ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.1 processing 'F. Delaglio' 1 CNS 1.1 'structure solution' 'A. Brunger et al.' 2 TALOS 1999.019.15.47 'data analysis' 'Cornilecu, Delaglio and Bax' 3 CNS 1.1 refinement 'A. Brunger et al.' 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 8OG OP3 O N N 1 8OG P P N N 2 8OG OP1 O N N 3 8OG OP2 O N N 4 8OG "O5'" O N N 5 8OG "C5'" C N N 6 8OG "C4'" C N R 7 8OG "O4'" O N N 8 8OG "C3'" C N S 9 8OG "O3'" O N N 10 8OG "C2'" C N N 11 8OG "C1'" C N R 12 8OG N9 N N N 13 8OG C8 C N N 14 8OG N7 N N N 15 8OG C5 C N N 16 8OG C6 C N N 17 8OG O6 O N N 18 8OG N1 N N N 19 8OG C2 C N N 20 8OG N2 N N N 21 8OG N3 N N N 22 8OG C4 C N N 23 8OG O8 O N N 24 8OG HOP3 H N N 25 8OG HOP2 H N N 26 8OG "H5'" H N N 27 8OG "H5''" H N N 28 8OG "H4'" H N N 29 8OG "H3'" H N N 30 8OG "HO3'" H N N 31 8OG "H2'" H N N 32 8OG "H2''" H N N 33 8OG "H1'" H N N 34 8OG H7 H N N 35 8OG H1 H N N 36 8OG H21 H N N 37 8OG H22 H N N 38 ALA N N N N 39 ALA CA C N S 40 ALA C C N N 41 ALA O O N N 42 ALA CB C N N 43 ALA OXT O N N 44 ALA H H N N 45 ALA H2 H N N 46 ALA HA H N N 47 ALA HB1 H N N 48 ALA HB2 H N N 49 ALA HB3 H N N 50 ALA HXT H N N 51 ARG N N N N 52 ARG CA C N S 53 ARG C C N N 54 ARG O O N N 55 ARG CB C N N 56 ARG CG C N N 57 ARG CD C N N 58 ARG NE N N N 59 ARG CZ C N N 60 ARG NH1 N N N 61 ARG NH2 N N N 62 ARG OXT O N N 63 ARG H H N N 64 ARG H2 H N N 65 ARG HA H N N 66 ARG HB2 H N N 67 ARG HB3 H N N 68 ARG HG2 H N N 69 ARG HG3 H N N 70 ARG HD2 H N N 71 ARG HD3 H N N 72 ARG HE H N N 73 ARG HH11 H N N 74 ARG HH12 H N N 75 ARG HH21 H N N 76 ARG HH22 H N N 77 ARG HXT H N N 78 ASN N N N N 79 ASN CA C N S 80 ASN C C N N 81 ASN O O N N 82 ASN CB C N N 83 ASN CG C N N 84 ASN OD1 O N N 85 ASN ND2 N N N 86 ASN OXT O N N 87 ASN H H N N 88 ASN H2 H N N 89 ASN HA H N N 90 ASN HB2 H N N 91 ASN HB3 H N N 92 ASN HD21 H N N 93 ASN HD22 H N N 94 ASN HXT H N N 95 ASP N N N N 96 ASP CA C N S 97 ASP C C N N 98 ASP O O N N 99 ASP CB C N N 100 ASP CG C N N 101 ASP OD1 O N N 102 ASP OD2 O N N 103 ASP OXT O N N 104 ASP H H N N 105 ASP H2 H N N 106 ASP HA H N N 107 ASP HB2 H N N 108 ASP HB3 H N N 109 ASP HD2 H N N 110 ASP HXT H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 MG MG MG N N 274 PHE N N N N 275 PHE CA C N S 276 PHE C C N N 277 PHE O O N N 278 PHE CB C N N 279 PHE CG C Y N 280 PHE CD1 C Y N 281 PHE CD2 C Y N 282 PHE CE1 C Y N 283 PHE CE2 C Y N 284 PHE CZ C Y N 285 PHE OXT O N N 286 PHE H H N N 287 PHE H2 H N N 288 PHE HA H N N 289 PHE HB2 H N N 290 PHE HB3 H N N 291 PHE HD1 H N N 292 PHE HD2 H N N 293 PHE HE1 H N N 294 PHE HE2 H N N 295 PHE HZ H N N 296 PHE HXT H N N 297 PRO N N N N 298 PRO CA C N S 299 PRO C C N N 300 PRO O O N N 301 PRO CB C N N 302 PRO CG C N N 303 PRO CD C N N 304 PRO OXT O N N 305 PRO H H N N 306 PRO HA H N N 307 PRO HB2 H N N 308 PRO HB3 H N N 309 PRO HG2 H N N 310 PRO HG3 H N N 311 PRO HD2 H N N 312 PRO HD3 H N N 313 PRO HXT H N N 314 SER N N N N 315 SER CA C N S 316 SER C C N N 317 SER O O N N 318 SER CB C N N 319 SER OG O N N 320 SER OXT O N N 321 SER H H N N 322 SER H2 H N N 323 SER HA H N N 324 SER HB2 H N N 325 SER HB3 H N N 326 SER HG H N N 327 SER HXT H N N 328 THR N N N N 329 THR CA C N S 330 THR C C N N 331 THR O O N N 332 THR CB C N R 333 THR OG1 O N N 334 THR CG2 C N N 335 THR OXT O N N 336 THR H H N N 337 THR H2 H N N 338 THR HA H N N 339 THR HB H N N 340 THR HG1 H N N 341 THR HG21 H N N 342 THR HG22 H N N 343 THR HG23 H N N 344 THR HXT H N N 345 TRP N N N N 346 TRP CA C N S 347 TRP C C N N 348 TRP O O N N 349 TRP CB C N N 350 TRP CG C Y N 351 TRP CD1 C Y N 352 TRP CD2 C Y N 353 TRP NE1 N Y N 354 TRP CE2 C Y N 355 TRP CE3 C Y N 356 TRP CZ2 C Y N 357 TRP CZ3 C Y N 358 TRP CH2 C Y N 359 TRP OXT O N N 360 TRP H H N N 361 TRP H2 H N N 362 TRP HA H N N 363 TRP HB2 H N N 364 TRP HB3 H N N 365 TRP HD1 H N N 366 TRP HE1 H N N 367 TRP HE3 H N N 368 TRP HZ2 H N N 369 TRP HZ3 H N N 370 TRP HH2 H N N 371 TRP HXT H N N 372 TYR N N N N 373 TYR CA C N S 374 TYR C C N N 375 TYR O O N N 376 TYR CB C N N 377 TYR CG C Y N 378 TYR CD1 C Y N 379 TYR CD2 C Y N 380 TYR CE1 C Y N 381 TYR CE2 C Y N 382 TYR CZ C Y N 383 TYR OH O N N 384 TYR OXT O N N 385 TYR H H N N 386 TYR H2 H N N 387 TYR HA H N N 388 TYR HB2 H N N 389 TYR HB3 H N N 390 TYR HD1 H N N 391 TYR HD2 H N N 392 TYR HE1 H N N 393 TYR HE2 H N N 394 TYR HH H N N 395 TYR HXT H N N 396 VAL N N N N 397 VAL CA C N S 398 VAL C C N N 399 VAL O O N N 400 VAL CB C N N 401 VAL CG1 C N N 402 VAL CG2 C N N 403 VAL OXT O N N 404 VAL H H N N 405 VAL H2 H N N 406 VAL HA H N N 407 VAL HB H N N 408 VAL HG11 H N N 409 VAL HG12 H N N 410 VAL HG13 H N N 411 VAL HG21 H N N 412 VAL HG22 H N N 413 VAL HG23 H N N 414 VAL HXT H N N 415 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 8OG OP3 P sing N N 1 8OG OP3 HOP3 sing N N 2 8OG P OP1 doub N N 3 8OG P OP2 sing N N 4 8OG P "O5'" sing N N 5 8OG OP2 HOP2 sing N N 6 8OG "O5'" "C5'" sing N N 7 8OG "C5'" "C4'" sing N N 8 8OG "C5'" "H5'" sing N N 9 8OG "C5'" "H5''" sing N N 10 8OG "C4'" "O4'" sing N N 11 8OG "C4'" "C3'" sing N N 12 8OG "C4'" "H4'" sing N N 13 8OG "O4'" "C1'" sing N N 14 8OG "C3'" "O3'" sing N N 15 8OG "C3'" "C2'" sing N N 16 8OG "C3'" "H3'" sing N N 17 8OG "O3'" "HO3'" sing N N 18 8OG "C2'" "C1'" sing N N 19 8OG "C2'" "H2'" sing N N 20 8OG "C2'" "H2''" sing N N 21 8OG "C1'" N9 sing N N 22 8OG "C1'" "H1'" sing N N 23 8OG N9 C8 sing N N 24 8OG N9 C4 sing N N 25 8OG C8 N7 sing N N 26 8OG C8 O8 doub N N 27 8OG N7 C5 sing N N 28 8OG N7 H7 sing N N 29 8OG C5 C6 sing N N 30 8OG C5 C4 doub N N 31 8OG C6 O6 doub N N 32 8OG C6 N1 sing N N 33 8OG N1 C2 sing N N 34 8OG N1 H1 sing N N 35 8OG C2 N2 sing N N 36 8OG C2 N3 doub N N 37 8OG N2 H21 sing N N 38 8OG N2 H22 sing N N 39 8OG N3 C4 sing N N 40 ALA N CA sing N N 41 ALA N H sing N N 42 ALA N H2 sing N N 43 ALA CA C sing N N 44 ALA CA CB sing N N 45 ALA CA HA sing N N 46 ALA C O doub N N 47 ALA C OXT sing N N 48 ALA CB HB1 sing N N 49 ALA CB HB2 sing N N 50 ALA CB HB3 sing N N 51 ALA OXT HXT sing N N 52 ARG N CA sing N N 53 ARG N H sing N N 54 ARG N H2 sing N N 55 ARG CA C sing N N 56 ARG CA CB sing N N 57 ARG CA HA sing N N 58 ARG C O doub N N 59 ARG C OXT sing N N 60 ARG CB CG sing N N 61 ARG CB HB2 sing N N 62 ARG CB HB3 sing N N 63 ARG CG CD sing N N 64 ARG CG HG2 sing N N 65 ARG CG HG3 sing N N 66 ARG CD NE sing N N 67 ARG CD HD2 sing N N 68 ARG CD HD3 sing N N 69 ARG NE CZ sing N N 70 ARG NE HE sing N N 71 ARG CZ NH1 sing N N 72 ARG CZ NH2 doub N N 73 ARG NH1 HH11 sing N N 74 ARG NH1 HH12 sing N N 75 ARG NH2 HH21 sing N N 76 ARG NH2 HH22 sing N N 77 ARG OXT HXT sing N N 78 ASN N CA sing N N 79 ASN N H sing N N 80 ASN N H2 sing N N 81 ASN CA C sing N N 82 ASN CA CB sing N N 83 ASN CA HA sing N N 84 ASN C O doub N N 85 ASN C OXT sing N N 86 ASN CB CG sing N N 87 ASN CB HB2 sing N N 88 ASN CB HB3 sing N N 89 ASN CG OD1 doub N N 90 ASN CG ND2 sing N N 91 ASN ND2 HD21 sing N N 92 ASN ND2 HD22 sing N N 93 ASN OXT HXT sing N N 94 ASP N CA sing N N 95 ASP N H sing N N 96 ASP N H2 sing N N 97 ASP CA C sing N N 98 ASP CA CB sing N N 99 ASP CA HA sing N N 100 ASP C O doub N N 101 ASP C OXT sing N N 102 ASP CB CG sing N N 103 ASP CB HB2 sing N N 104 ASP CB HB3 sing N N 105 ASP CG OD1 doub N N 106 ASP CG OD2 sing N N 107 ASP OD2 HD2 sing N N 108 ASP OXT HXT sing N N 109 GLN N CA sing N N 110 GLN N H sing N N 111 GLN N H2 sing N N 112 GLN CA C sing N N 113 GLN CA CB sing N N 114 GLN CA HA sing N N 115 GLN C O doub N N 116 GLN C OXT sing N N 117 GLN CB CG sing N N 118 GLN CB HB2 sing N N 119 GLN CB HB3 sing N N 120 GLN CG CD sing N N 121 GLN CG HG2 sing N N 122 GLN CG HG3 sing N N 123 GLN CD OE1 doub N N 124 GLN CD NE2 sing N N 125 GLN NE2 HE21 sing N N 126 GLN NE2 HE22 sing N N 127 GLN OXT HXT sing N N 128 GLU N CA sing N N 129 GLU N H sing N N 130 GLU N H2 sing N N 131 GLU CA C sing N N 132 GLU CA CB sing N N 133 GLU CA HA sing N N 134 GLU C O doub N N 135 GLU C OXT sing N N 136 GLU CB CG sing N N 137 GLU CB HB2 sing N N 138 GLU CB HB3 sing N N 139 GLU CG CD sing N N 140 GLU CG HG2 sing N N 141 GLU CG HG3 sing N N 142 GLU CD OE1 doub N N 143 GLU CD OE2 sing N N 144 GLU OE2 HE2 sing N N 145 GLU OXT HXT sing N N 146 GLY N CA sing N N 147 GLY N H sing N N 148 GLY N H2 sing N N 149 GLY CA C sing N N 150 GLY CA HA2 sing N N 151 GLY CA HA3 sing N N 152 GLY C O doub N N 153 GLY C OXT sing N N 154 GLY OXT HXT sing N N 155 HIS N CA sing N N 156 HIS N H sing N N 157 HIS N H2 sing N N 158 HIS CA C sing N N 159 HIS CA CB sing N N 160 HIS CA HA sing N N 161 HIS C O doub N N 162 HIS C OXT sing N N 163 HIS CB CG sing N N 164 HIS CB HB2 sing N N 165 HIS CB HB3 sing N N 166 HIS CG ND1 sing Y N 167 HIS CG CD2 doub Y N 168 HIS ND1 CE1 doub Y N 169 HIS ND1 HD1 sing N N 170 HIS CD2 NE2 sing Y N 171 HIS CD2 HD2 sing N N 172 HIS CE1 NE2 sing Y N 173 HIS CE1 HE1 sing N N 174 HIS NE2 HE2 sing N N 175 HIS OXT HXT sing N N 176 HOH O H1 sing N N 177 HOH O H2 sing N N 178 ILE N CA sing N N 179 ILE N H sing N N 180 ILE N H2 sing N N 181 ILE CA C sing N N 182 ILE CA CB sing N N 183 ILE CA HA sing N N 184 ILE C O doub N N 185 ILE C OXT sing N N 186 ILE CB CG1 sing N N 187 ILE CB CG2 sing N N 188 ILE CB HB sing N N 189 ILE CG1 CD1 sing N N 190 ILE CG1 HG12 sing N N 191 ILE CG1 HG13 sing N N 192 ILE CG2 HG21 sing N N 193 ILE CG2 HG22 sing N N 194 ILE CG2 HG23 sing N N 195 ILE CD1 HD11 sing N N 196 ILE CD1 HD12 sing N N 197 ILE CD1 HD13 sing N N 198 ILE OXT HXT sing N N 199 LEU N CA sing N N 200 LEU N H sing N N 201 LEU N H2 sing N N 202 LEU CA C sing N N 203 LEU CA CB sing N N 204 LEU CA HA sing N N 205 LEU C O doub N N 206 LEU C OXT sing N N 207 LEU CB CG sing N N 208 LEU CB HB2 sing N N 209 LEU CB HB3 sing N N 210 LEU CG CD1 sing N N 211 LEU CG CD2 sing N N 212 LEU CG HG sing N N 213 LEU CD1 HD11 sing N N 214 LEU CD1 HD12 sing N N 215 LEU CD1 HD13 sing N N 216 LEU CD2 HD21 sing N N 217 LEU CD2 HD22 sing N N 218 LEU CD2 HD23 sing N N 219 LEU OXT HXT sing N N 220 LYS N CA sing N N 221 LYS N H sing N N 222 LYS N H2 sing N N 223 LYS CA C sing N N 224 LYS CA CB sing N N 225 LYS CA HA sing N N 226 LYS C O doub N N 227 LYS C OXT sing N N 228 LYS CB CG sing N N 229 LYS CB HB2 sing N N 230 LYS CB HB3 sing N N 231 LYS CG CD sing N N 232 LYS CG HG2 sing N N 233 LYS CG HG3 sing N N 234 LYS CD CE sing N N 235 LYS CD HD2 sing N N 236 LYS CD HD3 sing N N 237 LYS CE NZ sing N N 238 LYS CE HE2 sing N N 239 LYS CE HE3 sing N N 240 LYS NZ HZ1 sing N N 241 LYS NZ HZ2 sing N N 242 LYS NZ HZ3 sing N N 243 LYS OXT HXT sing N N 244 MET N CA sing N N 245 MET N H sing N N 246 MET N H2 sing N N 247 MET CA C sing N N 248 MET CA CB sing N N 249 MET CA HA sing N N 250 MET C O doub N N 251 MET C OXT sing N N 252 MET CB CG sing N N 253 MET CB HB2 sing N N 254 MET CB HB3 sing N N 255 MET CG SD sing N N 256 MET CG HG2 sing N N 257 MET CG HG3 sing N N 258 MET SD CE sing N N 259 MET CE HE1 sing N N 260 MET CE HE2 sing N N 261 MET CE HE3 sing N N 262 MET OXT HXT sing N N 263 PHE N CA sing N N 264 PHE N H sing N N 265 PHE N H2 sing N N 266 PHE CA C sing N N 267 PHE CA CB sing N N 268 PHE CA HA sing N N 269 PHE C O doub N N 270 PHE C OXT sing N N 271 PHE CB CG sing N N 272 PHE CB HB2 sing N N 273 PHE CB HB3 sing N N 274 PHE CG CD1 doub Y N 275 PHE CG CD2 sing Y N 276 PHE CD1 CE1 sing Y N 277 PHE CD1 HD1 sing N N 278 PHE CD2 CE2 doub Y N 279 PHE CD2 HD2 sing N N 280 PHE CE1 CZ doub Y N 281 PHE CE1 HE1 sing N N 282 PHE CE2 CZ sing Y N 283 PHE CE2 HE2 sing N N 284 PHE CZ HZ sing N N 285 PHE OXT HXT sing N N 286 PRO N CA sing N N 287 PRO N CD sing N N 288 PRO N H sing N N 289 PRO CA C sing N N 290 PRO CA CB sing N N 291 PRO CA HA sing N N 292 PRO C O doub N N 293 PRO C OXT sing N N 294 PRO CB CG sing N N 295 PRO CB HB2 sing N N 296 PRO CB HB3 sing N N 297 PRO CG CD sing N N 298 PRO CG HG2 sing N N 299 PRO CG HG3 sing N N 300 PRO CD HD2 sing N N 301 PRO CD HD3 sing N N 302 PRO OXT HXT sing N N 303 SER N CA sing N N 304 SER N H sing N N 305 SER N H2 sing N N 306 SER CA C sing N N 307 SER CA CB sing N N 308 SER CA HA sing N N 309 SER C O doub N N 310 SER C OXT sing N N 311 SER CB OG sing N N 312 SER CB HB2 sing N N 313 SER CB HB3 sing N N 314 SER OG HG sing N N 315 SER OXT HXT sing N N 316 THR N CA sing N N 317 THR N H sing N N 318 THR N H2 sing N N 319 THR CA C sing N N 320 THR CA CB sing N N 321 THR CA HA sing N N 322 THR C O doub N N 323 THR C OXT sing N N 324 THR CB OG1 sing N N 325 THR CB CG2 sing N N 326 THR CB HB sing N N 327 THR OG1 HG1 sing N N 328 THR CG2 HG21 sing N N 329 THR CG2 HG22 sing N N 330 THR CG2 HG23 sing N N 331 THR OXT HXT sing N N 332 TRP N CA sing N N 333 TRP N H sing N N 334 TRP N H2 sing N N 335 TRP CA C sing N N 336 TRP CA CB sing N N 337 TRP CA HA sing N N 338 TRP C O doub N N 339 TRP C OXT sing N N 340 TRP CB CG sing N N 341 TRP CB HB2 sing N N 342 TRP CB HB3 sing N N 343 TRP CG CD1 doub Y N 344 TRP CG CD2 sing Y N 345 TRP CD1 NE1 sing Y N 346 TRP CD1 HD1 sing N N 347 TRP CD2 CE2 doub Y N 348 TRP CD2 CE3 sing Y N 349 TRP NE1 CE2 sing Y N 350 TRP NE1 HE1 sing N N 351 TRP CE2 CZ2 sing Y N 352 TRP CE3 CZ3 doub Y N 353 TRP CE3 HE3 sing N N 354 TRP CZ2 CH2 doub Y N 355 TRP CZ2 HZ2 sing N N 356 TRP CZ3 CH2 sing Y N 357 TRP CZ3 HZ3 sing N N 358 TRP CH2 HH2 sing N N 359 TRP OXT HXT sing N N 360 TYR N CA sing N N 361 TYR N H sing N N 362 TYR N H2 sing N N 363 TYR CA C sing N N 364 TYR CA CB sing N N 365 TYR CA HA sing N N 366 TYR C O doub N N 367 TYR C OXT sing N N 368 TYR CB CG sing N N 369 TYR CB HB2 sing N N 370 TYR CB HB3 sing N N 371 TYR CG CD1 doub Y N 372 TYR CG CD2 sing Y N 373 TYR CD1 CE1 sing Y N 374 TYR CD1 HD1 sing N N 375 TYR CD2 CE2 doub Y N 376 TYR CD2 HD2 sing N N 377 TYR CE1 CZ doub Y N 378 TYR CE1 HE1 sing N N 379 TYR CE2 CZ sing Y N 380 TYR CE2 HE2 sing N N 381 TYR CZ OH sing N N 382 TYR OH HH sing N N 383 TYR OXT HXT sing N N 384 VAL N CA sing N N 385 VAL N H sing N N 386 VAL N H2 sing N N 387 VAL CA C sing N N 388 VAL CA CB sing N N 389 VAL CA HA sing N N 390 VAL C O doub N N 391 VAL C OXT sing N N 392 VAL CB CG1 sing N N 393 VAL CB CG2 sing N N 394 VAL CB HB sing N N 395 VAL CG1 HG11 sing N N 396 VAL CG1 HG12 sing N N 397 VAL CG1 HG13 sing N N 398 VAL CG2 HG21 sing N N 399 VAL CG2 HG22 sing N N 400 VAL CG2 HG23 sing N N 401 VAL OXT HXT sing N N 402 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1PUQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H MG N O P S # loop_