data_1Q3J # _entry.id 1Q3J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1Q3J RCSB RCSB019870 WWPDB D_1000019870 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Q3J _pdbx_database_status.recvd_initial_deposition_date 2003-07-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Barbault, F.' 1 'Landon, C.' 2 'Guenneugues, M.' 3 'Meyer, J.P.' 4 'Schott, V.' 5 'Dimarrcq, J.L.' 6 'Vovelle, F.' 7 # _citation.id primary _citation.title 'Solution structure of Alo-3: a new knottin-type antifungal peptide from the insect Acrocinus longimanus.' _citation.journal_abbrev Biochemistry _citation.journal_volume 42 _citation.page_first 14434 _citation.page_last 14442 _citation.year 2003 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14661954 _citation.pdbx_database_id_DOI 10.1021/bi035400o # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Barbault, F.' 1 primary 'Landon, C.' 2 primary 'Guenneugues, M.' 3 primary 'Meyer, J.P.' 4 primary 'Schott, V.' 5 primary 'Dimarcq, J.L.' 6 primary 'Vovelle, F.' 7 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description ALO3 _entity.formula_weight 3881.415 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK _entity_poly.pdbx_seq_one_letter_code_can CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 ILE n 1 3 LYS n 1 4 ASN n 1 5 GLY n 1 6 ASN n 1 7 GLY n 1 8 CYS n 1 9 GLN n 1 10 PRO n 1 11 ASN n 1 12 GLY n 1 13 SER n 1 14 GLN n 1 15 GLY n 1 16 ASN n 1 17 CYS n 1 18 CYS n 1 19 SER n 1 20 GLY n 1 21 TYR n 1 22 CYS n 1 23 HIS n 1 24 LYS n 1 25 GLN n 1 26 PRO n 1 27 GLY n 1 28 TRP n 1 29 VAL n 1 30 ALA n 1 31 GLY n 1 32 TYR n 1 33 CYS n 1 34 ARG n 1 35 ARG n 1 36 LYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;THE PEPTIDE WAS CHEMICALLY SYNTHESIZED. The sequence of the peptide is naturally found in Acrocinus longimanus (giant harlequin beetle). ; # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ALO3_ACRLO _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P83653 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Q3J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P83653 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 36 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 36 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D TOCSY' 2 1 1 DQF-COSY 3 1 2 '2D TOCSY' 4 1 1 '2D NOESY' 5 2 1 '2D TOCSY' 6 2 1 'kinetics exchange' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 293 ambient 5.2 ? ? K 2 303 ambient 5.2 ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 'peptide at 1.2mM, acetate buffer at 40mM, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 'peptide at 1.2mM, acetate buffer at 40mM, 100% D2O' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1Q3J _pdbx_nmr_refine.method 'simulated annealing with torsion angle space' _pdbx_nmr_refine.details 'Determination of disulfide pattern was done using ambiguous disulfide restraints.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1Q3J _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1Q3J _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy and the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1Q3J _pdbx_nmr_representative.conformer_id 4 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.2 processing 'Delaglio, F.' 1 NMRview 5.0 'data analysis' 'Johnson, B.A.' 2 ARIA 1.1 'structure solution' 'Nilges, M.' 3 CNS 1.1 'structure solution' 'Brunger, A.T.' 4 Molmol 2k1 'data analysis' 'Koradi, R.' 5 CNS 1.1 refinement 'Brunger, A.T.' 6 # _exptl.entry_id 1Q3J _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1Q3J _struct.title 'Solution structure of ALO3: a new knottin-type antifungal peptide from the insect Acrocinus longimanus' _struct.pdbx_descriptor ALO3 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Q3J _struct_keywords.pdbx_keywords 'ANTIFUNGAL PROTEIN' _struct_keywords.text 'knottin, cystine-knot, ANTIFUNGAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 1 A CYS 18 1_555 ? ? ? ? ? ? ? 2.031 ? disulf2 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 8 A CYS 22 1_555 ? ? ? ? ? ? ? 2.030 ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 17 A CYS 33 1_555 ? ? ? ? ? ? ? 2.026 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 7 ? GLN A 9 ? GLY A 7 GLN A 9 A 2 GLY A 31 ? CYS A 33 ? GLY A 31 CYS A 33 A 3 CYS A 22 ? HIS A 23 ? CYS A 22 HIS A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 9 ? N GLN A 9 O GLY A 31 ? O GLY A 31 A 2 3 O TYR A 32 ? O TYR A 32 N HIS A 23 ? N HIS A 23 # _database_PDB_matrix.entry_id 1Q3J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1Q3J _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LYS 36 36 36 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-12-23 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 2 ? ? 70.60 158.03 2 1 LYS A 3 ? ? 78.47 149.03 3 1 CYS A 8 ? ? -140.88 -50.72 4 1 ASN A 11 ? ? -147.12 24.47 5 1 HIS A 23 ? ? -164.56 118.58 6 1 PRO A 26 ? ? -69.73 57.45 7 2 ILE A 2 ? ? 74.66 147.50 8 2 LYS A 3 ? ? 74.94 148.53 9 2 ASN A 11 ? ? -162.64 -31.93 10 2 GLN A 14 ? ? 176.59 -46.23 11 2 SER A 19 ? ? -173.77 -35.87 12 2 TYR A 21 ? ? 72.81 115.08 13 2 TRP A 28 ? ? -158.75 12.12 14 2 VAL A 29 ? ? 31.26 44.54 15 2 ALA A 30 ? ? -179.09 106.05 16 2 ARG A 34 ? ? -83.70 -144.35 17 3 LYS A 3 ? ? -153.55 24.68 18 3 ASN A 4 ? ? 59.08 121.73 19 3 GLN A 9 ? ? -154.79 64.55 20 3 GLN A 14 ? ? -169.46 -142.32 21 3 SER A 19 ? ? -153.71 45.93 22 3 TYR A 21 ? ? 67.31 74.08 23 4 ASN A 11 ? ? -160.67 36.47 24 4 PRO A 26 ? ? -66.37 48.03 25 5 ASN A 4 ? ? -67.75 67.43 26 5 GLN A 9 ? ? -154.36 77.19 27 5 ASN A 11 ? ? 69.38 -57.06 28 5 CYS A 22 ? ? -68.62 80.09 29 5 LYS A 24 ? ? -141.85 44.98 30 5 ARG A 34 ? ? -90.68 47.69 31 5 ARG A 35 ? ? -177.19 -147.53 32 6 LYS A 3 ? ? -86.54 45.14 33 6 ASN A 11 ? ? -158.41 56.68 34 6 ASN A 16 ? ? -177.12 149.57 35 6 TYR A 21 ? ? -96.80 56.94 36 6 PRO A 26 ? ? -69.03 32.01 37 6 VAL A 29 ? ? -85.85 -79.58 38 7 ASN A 11 ? ? 75.30 -56.22 39 7 SER A 13 ? ? -159.03 -58.51 40 7 GLN A 14 ? ? -171.33 133.65 41 7 ASN A 16 ? ? -177.20 146.74 42 7 TYR A 21 ? ? -160.33 117.97 43 7 GLN A 25 ? ? -121.34 -62.84 44 7 PRO A 26 ? ? -85.24 -156.67 45 7 TRP A 28 ? ? 27.07 50.41 46 7 VAL A 29 ? ? 70.75 -57.45 47 7 ALA A 30 ? ? -171.73 146.60 48 7 ARG A 35 ? ? 72.01 -51.10 49 8 ILE A 2 ? ? 70.16 120.83 50 8 ASN A 11 ? ? -158.49 55.36 51 8 GLN A 14 ? ? 69.85 -59.80 52 8 ASN A 16 ? ? -176.75 -138.65 53 8 CYS A 18 ? ? -38.28 -38.70 54 8 ARG A 35 ? ? 64.78 -98.79 55 9 ILE A 2 ? ? 67.71 72.47 56 9 ASN A 11 ? ? -159.69 40.29 57 9 GLN A 14 ? ? 179.41 -60.99 58 9 TYR A 21 ? ? 58.90 92.72 59 9 PRO A 26 ? ? -67.67 52.53 60 9 TRP A 28 ? ? -151.31 28.80 61 9 VAL A 29 ? ? 67.80 -53.27 62 10 ASN A 11 ? ? 58.81 71.06 63 10 GLN A 25 ? ? -147.39 -51.98 64 10 ARG A 35 ? ? -84.72 -154.38 #