data_1Q61 # _entry.id 1Q61 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Q61 pdb_00001q61 10.2210/pdb1q61/pdb RCSB RCSB019960 ? ? WWPDB D_1000019960 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1Q24 'PKA double mutant model of PKB in complex with MgATP' unspecified PDB 1Q62 'PKA double mutant model of PKB' unspecified PDB 1CDK ;CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT COMPLEXED WITH PROTEIN KINASE INHIBITOR PEPTIDE FRAGMENT 5-24 AND MN2+ ADENYLYL IMIDODIPHOSPHATE AT PH 5.6 AND 7C AND 4C ; unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Q61 _pdbx_database_status.recvd_initial_deposition_date 2003-08-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gassel, M.' 1 'Breitenlechner, C.B.' 2 'Rueger, P.' 3 'Jucknischke, U.' 4 'Schneider, T.' 5 'Huber, R.' 6 'Bossemeyer, D.' 7 'Engh, R.A.' 8 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Mutants of protein kinase A that mimic the ATP-binding site of protein kinase B (AKT)' J.Mol.Biol. 329 1021 1034 2003 JMOBAK UK 0022-2836 0070 ? 12798691 '10.1016/S0022-2836(03)00518-7' 1 ;Phosphotransferase and substrate binding mechanism of the cAMP-dependent protein kinase catalytic subunit from porcine heart as deduced from the 2.0 A structure of the complex with Mn2+ adenylyl imidodiphosphate and inhibitor peptide PKI(5-24) ; 'Embo J.' 12 849 859 1993 EMJODG UK 0261-4189 0897 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gassel, M.' 1 ? primary 'Breitenlechner, C.B.' 2 ? primary 'Rueger, P.' 3 ? primary 'Jucknischke, U.' 4 ? primary 'Schneider, T.' 5 ? primary 'Huber, R.' 6 ? primary 'Bossemeyer, D.' 7 ? primary 'Engh, R.A.' 8 ? 1 'Bossemeyer, D.' 9 ? 1 'Engh, R.A.' 10 ? 1 'Kinzel, V.' 11 ? 1 'Ponstingl, H.' 12 ? 1 'Huber, R.' 13 ? # _cell.entry_id 1Q61 _cell.length_a 59.870 _cell.length_b 79.420 _cell.length_c 100.886 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1Q61 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'cAMP-dependent protein kinase, alpha-catalytic subunit' 40697.449 1 2.7.1.37 'V123A, L173M, Q181K' ? ? 2 polymer syn 'cAMP-dependent protein kinase inhibitor, alpha form' 2226.411 1 ? ? 'residues 5-24' ? 3 non-polymer syn N-OCTANOYL-N-METHYLGLUCAMINE 321.410 1 ? ? ? ? 4 water nat water 18.015 154 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'PKA C-alpha' 2 'PKI-alpha, cAMP-dependent protein kinase inhibitor, muscle/brain isoform' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVV KLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSL DLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTW(TPO)LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIP KFKGPGDTSNFDDYEEEEIRV(SEP)INEKCGKEFSEF ; ;GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVV KLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSL DLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKG PGDTSNFDDYEEEEIRVSINEKCGKEFSEF ; A ? 2 'polypeptide(L)' no no TTYADFIASGRTGRRNAIHD TTYADFIASGRTGRRNAIHD I ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASN n 1 3 ALA n 1 4 ALA n 1 5 ALA n 1 6 ALA n 1 7 LYS n 1 8 LYS n 1 9 GLY n 1 10 SER n 1 11 GLU n 1 12 GLN n 1 13 GLU n 1 14 SER n 1 15 VAL n 1 16 LYS n 1 17 GLU n 1 18 PHE n 1 19 LEU n 1 20 ALA n 1 21 LYS n 1 22 ALA n 1 23 LYS n 1 24 GLU n 1 25 ASP n 1 26 PHE n 1 27 LEU n 1 28 LYS n 1 29 LYS n 1 30 TRP n 1 31 GLU n 1 32 ASN n 1 33 PRO n 1 34 ALA n 1 35 GLN n 1 36 ASN n 1 37 THR n 1 38 ALA n 1 39 HIS n 1 40 LEU n 1 41 ASP n 1 42 GLN n 1 43 PHE n 1 44 GLU n 1 45 ARG n 1 46 ILE n 1 47 LYS n 1 48 THR n 1 49 LEU n 1 50 GLY n 1 51 THR n 1 52 GLY n 1 53 SER n 1 54 PHE n 1 55 GLY n 1 56 ARG n 1 57 VAL n 1 58 MET n 1 59 LEU n 1 60 VAL n 1 61 LYS n 1 62 HIS n 1 63 MET n 1 64 GLU n 1 65 THR n 1 66 GLY n 1 67 ASN n 1 68 HIS n 1 69 TYR n 1 70 ALA n 1 71 MET n 1 72 LYS n 1 73 ILE n 1 74 LEU n 1 75 ASP n 1 76 LYS n 1 77 GLN n 1 78 LYS n 1 79 VAL n 1 80 VAL n 1 81 LYS n 1 82 LEU n 1 83 LYS n 1 84 GLN n 1 85 ILE n 1 86 GLU n 1 87 HIS n 1 88 THR n 1 89 LEU n 1 90 ASN n 1 91 GLU n 1 92 LYS n 1 93 ARG n 1 94 ILE n 1 95 LEU n 1 96 GLN n 1 97 ALA n 1 98 VAL n 1 99 ASN n 1 100 PHE n 1 101 PRO n 1 102 PHE n 1 103 LEU n 1 104 VAL n 1 105 LYS n 1 106 LEU n 1 107 GLU n 1 108 PHE n 1 109 SER n 1 110 PHE n 1 111 LYS n 1 112 ASP n 1 113 ASN n 1 114 SER n 1 115 ASN n 1 116 LEU n 1 117 TYR n 1 118 MET n 1 119 VAL n 1 120 MET n 1 121 GLU n 1 122 TYR n 1 123 ALA n 1 124 PRO n 1 125 GLY n 1 126 GLY n 1 127 GLU n 1 128 MET n 1 129 PHE n 1 130 SER n 1 131 HIS n 1 132 LEU n 1 133 ARG n 1 134 ARG n 1 135 ILE n 1 136 GLY n 1 137 ARG n 1 138 PHE n 1 139 SER n 1 140 GLU n 1 141 PRO n 1 142 HIS n 1 143 ALA n 1 144 ARG n 1 145 PHE n 1 146 TYR n 1 147 ALA n 1 148 ALA n 1 149 GLN n 1 150 ILE n 1 151 VAL n 1 152 LEU n 1 153 THR n 1 154 PHE n 1 155 GLU n 1 156 TYR n 1 157 LEU n 1 158 HIS n 1 159 SER n 1 160 LEU n 1 161 ASP n 1 162 LEU n 1 163 ILE n 1 164 TYR n 1 165 ARG n 1 166 ASP n 1 167 LEU n 1 168 LYS n 1 169 PRO n 1 170 GLU n 1 171 ASN n 1 172 LEU n 1 173 MET n 1 174 ILE n 1 175 ASP n 1 176 GLN n 1 177 GLN n 1 178 GLY n 1 179 TYR n 1 180 ILE n 1 181 LYS n 1 182 VAL n 1 183 THR n 1 184 ASP n 1 185 PHE n 1 186 GLY n 1 187 PHE n 1 188 ALA n 1 189 LYS n 1 190 ARG n 1 191 VAL n 1 192 LYS n 1 193 GLY n 1 194 ARG n 1 195 THR n 1 196 TRP n 1 197 TPO n 1 198 LEU n 1 199 CYS n 1 200 GLY n 1 201 THR n 1 202 PRO n 1 203 GLU n 1 204 TYR n 1 205 LEU n 1 206 ALA n 1 207 PRO n 1 208 GLU n 1 209 ILE n 1 210 ILE n 1 211 LEU n 1 212 SER n 1 213 LYS n 1 214 GLY n 1 215 TYR n 1 216 ASN n 1 217 LYS n 1 218 ALA n 1 219 VAL n 1 220 ASP n 1 221 TRP n 1 222 TRP n 1 223 ALA n 1 224 LEU n 1 225 GLY n 1 226 VAL n 1 227 LEU n 1 228 ILE n 1 229 TYR n 1 230 GLU n 1 231 MET n 1 232 ALA n 1 233 ALA n 1 234 GLY n 1 235 TYR n 1 236 PRO n 1 237 PRO n 1 238 PHE n 1 239 PHE n 1 240 ALA n 1 241 ASP n 1 242 GLN n 1 243 PRO n 1 244 ILE n 1 245 GLN n 1 246 ILE n 1 247 TYR n 1 248 GLU n 1 249 LYS n 1 250 ILE n 1 251 VAL n 1 252 SER n 1 253 GLY n 1 254 LYS n 1 255 VAL n 1 256 ARG n 1 257 PHE n 1 258 PRO n 1 259 SER n 1 260 HIS n 1 261 PHE n 1 262 SER n 1 263 SER n 1 264 ASP n 1 265 LEU n 1 266 LYS n 1 267 ASP n 1 268 LEU n 1 269 LEU n 1 270 ARG n 1 271 ASN n 1 272 LEU n 1 273 LEU n 1 274 GLN n 1 275 VAL n 1 276 ASP n 1 277 LEU n 1 278 THR n 1 279 LYS n 1 280 ARG n 1 281 PHE n 1 282 GLY n 1 283 ASN n 1 284 LEU n 1 285 LYS n 1 286 ASN n 1 287 GLY n 1 288 VAL n 1 289 ASN n 1 290 ASP n 1 291 ILE n 1 292 LYS n 1 293 ASN n 1 294 HIS n 1 295 LYS n 1 296 TRP n 1 297 PHE n 1 298 ALA n 1 299 THR n 1 300 THR n 1 301 ASP n 1 302 TRP n 1 303 ILE n 1 304 ALA n 1 305 ILE n 1 306 TYR n 1 307 GLN n 1 308 ARG n 1 309 LYS n 1 310 VAL n 1 311 GLU n 1 312 ALA n 1 313 PRO n 1 314 PHE n 1 315 ILE n 1 316 PRO n 1 317 LYS n 1 318 PHE n 1 319 LYS n 1 320 GLY n 1 321 PRO n 1 322 GLY n 1 323 ASP n 1 324 THR n 1 325 SER n 1 326 ASN n 1 327 PHE n 1 328 ASP n 1 329 ASP n 1 330 TYR n 1 331 GLU n 1 332 GLU n 1 333 GLU n 1 334 GLU n 1 335 ILE n 1 336 ARG n 1 337 VAL n 1 338 SEP n 1 339 ILE n 1 340 ASN n 1 341 GLU n 1 342 LYS n 1 343 CYS n 1 344 GLY n 1 345 LYS n 1 346 GLU n 1 347 PHE n 1 348 SER n 1 349 GLU n 1 350 PHE n 2 1 THR n 2 2 THR n 2 3 TYR n 2 4 ALA n 2 5 ASP n 2 6 PHE n 2 7 ILE n 2 8 ALA n 2 9 SER n 2 10 GLY n 2 11 ARG n 2 12 THR n 2 13 GLY n 2 14 ARG n 2 15 ARG n 2 16 ASN n 2 17 ALA n 2 18 ILE n 2 19 HIS n 2 20 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene PRKACA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pT7-7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'THE PROTEIN WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THE PROTEIN IS NATURALLY FOUND IN Homo Sapiens.' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP KAPCA_BOVIN P00517 1 ;GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVV KLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSL DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKG PGDTSNFDDYEEEEIRVSINEKCGKEFSEF ; 1 ? 2 UNP IPKA_HUMANX P04541 2 TTYADFIASGRTGRRNAIHD 5 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1Q61 A 1 ? 350 ? P00517 1 ? 350 ? 1 350 2 2 1Q61 I 1 ? 20 ? P04541 5 ? 24 ? 5 24 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1Q61 ALA A 123 ? UNP P00517 VAL 123 'engineered mutation' 123 1 1 1Q61 MET A 173 ? UNP P00517 LEU 173 'engineered mutation' 173 2 1 1Q61 LYS A 181 ? UNP P00517 GLN 181 'engineered mutation' 181 3 1 1Q61 TPO A 197 ? UNP P00517 THR 197 'modified residue' 197 4 1 1Q61 SEP A 338 ? UNP P00517 SER 338 'modified residue' 338 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG8 non-polymer . N-OCTANOYL-N-METHYLGLUCAMINE 'MEGA 8; N-(D-GLUCITYL)-N-METHYLOCTANAMIDE' 'C15 H31 N O6' 321.410 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1Q61 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_percent_sol 55.96 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.4 _exptl_crystal_grow.pdbx_details 'MES-Bistris, LiCl, DTT, Mega8, PKI, methanol, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 290 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type BRUKER _diffrn_detector.pdbx_collection_date 2001-07-19 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Graphite crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1Q61 _reflns.number_all ? _reflns.number_obs 26309 _reflns.percent_possible_obs ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.10 _reflns.d_resolution_low 7.97 _reflns.pdbx_Rmerge_I_obs 0.14 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1Q61 _refine.ls_number_reflns_obs 23666 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 7.97 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 93.43 _refine.ls_R_factor_obs 0.18403 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.17859 _refine.ls_R_factor_R_free 0.23234 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free 2642 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.953 _refine.correlation_coeff_Fo_to_Fc_free 0.925 _refine.B_iso_mean 27.656 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] -0.01 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.204 _refine.pdbx_overall_ESU_R_Free 0.185 _refine.overall_SU_ML 0.132 _refine.overall_SU_B 5.091 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2941 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 154 _refine_hist.number_atoms_total 3103 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 7.97 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.017 0.021 ? 2953 'X-RAY DIFFRACTION' ? r_bond_other_d 0.006 0.020 ? 2645 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.585 1.942 ? 3995 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.926 3.000 ? 6118 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.046 5.000 ? 355 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_chiral_restr 0.104 0.200 ? 425 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.010 0.020 ? 3279 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.016 0.020 ? 648 'X-RAY DIFFRACTION' ? r_nbd_refined 0.212 0.200 ? 523 'X-RAY DIFFRACTION' ? r_nbd_other 0.238 0.200 ? 2907 'X-RAY DIFFRACTION' ? r_nbtor_other 0.091 0.200 ? 1719 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.159 0.200 ? 122 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.172 0.200 ? 9 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.259 0.200 ? 25 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.196 0.200 ? 13 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.859 1.500 ? 1777 'X-RAY DIFFRACTION' ? r_mcangle_it 1.595 2.000 ? 2852 'X-RAY DIFFRACTION' ? r_scbond_it 2.337 3.000 ? 1176 'X-RAY DIFFRACTION' ? r_scangle_it 3.809 4.500 ? 1143 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.100 _refine_ls_shell.d_res_low 2.151 _refine_ls_shell.number_reflns_R_work 1645 _refine_ls_shell.R_factor_R_work 0.241 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.327 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 152 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1Q61 _struct.title 'PKA triple mutant model of PKB' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Q61 _struct_keywords.pdbx_keywords 'Transferase/Transferase Inhibitor' _struct_keywords.text 'PKB-Model, Restoration of ATP-site, point mutation, Transferase-Transferase Inhibitor COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 14 ? ASN A 32 ? SER A 14 ASN A 32 1 ? 19 HELX_P HELX_P2 2 HIS A 39 ? ASP A 41 ? HIS A 39 ASP A 41 5 ? 3 HELX_P HELX_P3 3 LYS A 76 ? LEU A 82 ? LYS A 76 LEU A 82 1 ? 7 HELX_P HELX_P4 4 GLN A 84 ? GLN A 96 ? GLN A 84 GLN A 96 1 ? 13 HELX_P HELX_P5 5 GLU A 127 ? GLY A 136 ? GLU A 127 GLY A 136 1 ? 10 HELX_P HELX_P6 6 SER A 139 ? LEU A 160 ? SER A 139 LEU A 160 1 ? 22 HELX_P HELX_P7 7 LYS A 168 ? GLU A 170 ? LYS A 168 GLU A 170 5 ? 3 HELX_P HELX_P8 8 THR A 201 ? LEU A 205 ? THR A 201 LEU A 205 5 ? 5 HELX_P HELX_P9 9 ALA A 206 ? LEU A 211 ? ALA A 206 LEU A 211 1 ? 6 HELX_P HELX_P10 10 LYS A 217 ? GLY A 234 ? LYS A 217 GLY A 234 1 ? 18 HELX_P HELX_P11 11 GLN A 242 ? GLY A 253 ? GLN A 242 GLY A 253 1 ? 12 HELX_P HELX_P12 12 SER A 262 ? LEU A 273 ? SER A 262 LEU A 273 1 ? 12 HELX_P HELX_P13 13 VAL A 288 ? ASN A 293 ? VAL A 288 ASN A 293 1 ? 6 HELX_P HELX_P14 14 HIS A 294 ? ALA A 298 ? HIS A 294 ALA A 298 5 ? 5 HELX_P HELX_P15 15 ASP A 301 ? GLN A 307 ? ASP A 301 GLN A 307 1 ? 7 HELX_P HELX_P16 16 GLY A 344 ? SER A 348 ? GLY A 344 SER A 348 5 ? 5 HELX_P HELX_P17 17 THR B 1 ? SER B 9 ? THR I 5 SER I 13 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A TRP 196 C ? ? ? 1_555 A TPO 197 N ? ? A TRP 196 A TPO 197 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale2 covale both ? A TPO 197 C ? ? ? 1_555 A LEU 198 N ? ? A TPO 197 A LEU 198 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale3 covale both ? A VAL 337 C ? ? ? 1_555 A SEP 338 N ? ? A VAL 337 A SEP 338 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A SEP 338 C ? ? ? 1_555 A ILE 339 N ? ? A SEP 338 A ILE 339 1_555 ? ? ? ? ? ? ? 1.335 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 43 ? THR A 51 ? PHE A 43 THR A 51 A 2 GLY A 55 ? HIS A 62 ? GLY A 55 HIS A 62 A 3 HIS A 68 ? ASP A 75 ? HIS A 68 ASP A 75 A 4 ASN A 115 ? GLU A 121 ? ASN A 115 GLU A 121 A 5 LEU A 106 ? LYS A 111 ? LEU A 106 LYS A 111 B 1 LEU A 162 ? ILE A 163 ? LEU A 162 ILE A 163 B 2 LYS A 189 ? ARG A 190 ? LYS A 189 ARG A 190 C 1 LEU A 172 ? ILE A 174 ? LEU A 172 ILE A 174 C 2 ILE A 180 ? VAL A 182 ? ILE A 180 VAL A 182 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 47 ? N LYS A 47 O LEU A 59 ? O LEU A 59 A 2 3 N MET A 58 ? N MET A 58 O MET A 71 ? O MET A 71 A 3 4 N ALA A 70 ? N ALA A 70 O MET A 120 ? O MET A 120 A 4 5 O VAL A 119 ? O VAL A 119 N PHE A 108 ? N PHE A 108 B 1 2 N ILE A 163 ? N ILE A 163 O LYS A 189 ? O LYS A 189 C 1 2 N MET A 173 ? N MET A 173 O LYS A 181 ? O LYS A 181 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id MG8 _struct_site.pdbx_auth_seq_id 500 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE MG8 A 500' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 PHE A 18 ? PHE A 18 . ? 1_555 ? 2 AC1 3 LEU A 152 ? LEU A 152 . ? 1_555 ? 3 AC1 3 GLU A 155 ? GLU A 155 . ? 1_555 ? # _database_PDB_matrix.entry_id 1Q61 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1Q61 _atom_sites.fract_transf_matrix[1][1] 0.016703 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012591 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009912 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 ALA 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 GLU 11 11 ? ? ? A . n A 1 12 GLN 12 12 ? ? ? A . n A 1 13 GLU 13 13 ? ? ? A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 MET 128 128 128 MET MET A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 HIS 158 158 158 HIS HIS A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 MET 173 173 173 MET MET A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 ASP 184 184 184 ASP ASP A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 LYS 192 192 192 LYS LYS A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 TRP 196 196 196 TRP TRP A . n A 1 197 TPO 197 197 197 TPO TPO A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 CYS 199 199 199 CYS CYS A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 THR 201 201 201 THR THR A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 TYR 204 204 204 TYR TYR A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 PRO 207 207 207 PRO PRO A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 ASP 220 220 220 ASP ASP A . n A 1 221 TRP 221 221 221 TRP TRP A . n A 1 222 TRP 222 222 222 TRP TRP A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 TYR 229 229 229 TYR TYR A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 MET 231 231 231 MET MET A . n A 1 232 ALA 232 232 232 ALA ALA A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 TYR 235 235 235 TYR TYR A . n A 1 236 PRO 236 236 236 PRO PRO A . n A 1 237 PRO 237 237 237 PRO PRO A . n A 1 238 PHE 238 238 238 PHE PHE A . n A 1 239 PHE 239 239 239 PHE PHE A . n A 1 240 ALA 240 240 240 ALA ALA A . n A 1 241 ASP 241 241 241 ASP ASP A . n A 1 242 GLN 242 242 242 GLN GLN A . n A 1 243 PRO 243 243 243 PRO PRO A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 GLN 245 245 245 GLN GLN A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 TYR 247 247 247 TYR TYR A . n A 1 248 GLU 248 248 248 GLU GLU A . n A 1 249 LYS 249 249 249 LYS LYS A . n A 1 250 ILE 250 250 250 ILE ILE A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 SER 252 252 252 SER SER A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 LYS 254 254 254 LYS LYS A . n A 1 255 VAL 255 255 255 VAL VAL A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 PHE 257 257 257 PHE PHE A . n A 1 258 PRO 258 258 258 PRO PRO A . n A 1 259 SER 259 259 259 SER SER A . n A 1 260 HIS 260 260 260 HIS HIS A . n A 1 261 PHE 261 261 261 PHE PHE A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 SER 263 263 263 SER SER A . n A 1 264 ASP 264 264 264 ASP ASP A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 LYS 266 266 266 LYS LYS A . n A 1 267 ASP 267 267 267 ASP ASP A . n A 1 268 LEU 268 268 268 LEU LEU A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 ARG 270 270 270 ARG ARG A . n A 1 271 ASN 271 271 271 ASN ASN A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 GLN 274 274 274 GLN GLN A . n A 1 275 VAL 275 275 275 VAL VAL A . n A 1 276 ASP 276 276 276 ASP ASP A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 THR 278 278 278 THR THR A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 ARG 280 280 280 ARG ARG A . n A 1 281 PHE 281 281 281 PHE PHE A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 ASN 283 283 283 ASN ASN A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 LYS 285 285 285 LYS LYS A . n A 1 286 ASN 286 286 286 ASN ASN A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 VAL 288 288 288 VAL VAL A . n A 1 289 ASN 289 289 289 ASN ASN A . n A 1 290 ASP 290 290 290 ASP ASP A . n A 1 291 ILE 291 291 291 ILE ILE A . n A 1 292 LYS 292 292 292 LYS LYS A . n A 1 293 ASN 293 293 293 ASN ASN A . n A 1 294 HIS 294 294 294 HIS HIS A . n A 1 295 LYS 295 295 295 LYS LYS A . n A 1 296 TRP 296 296 296 TRP TRP A . n A 1 297 PHE 297 297 297 PHE PHE A . n A 1 298 ALA 298 298 298 ALA ALA A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 THR 300 300 300 THR THR A . n A 1 301 ASP 301 301 301 ASP ASP A . n A 1 302 TRP 302 302 302 TRP TRP A . n A 1 303 ILE 303 303 303 ILE ILE A . n A 1 304 ALA 304 304 304 ALA ALA A . n A 1 305 ILE 305 305 305 ILE ILE A . n A 1 306 TYR 306 306 306 TYR TYR A . n A 1 307 GLN 307 307 307 GLN GLN A . n A 1 308 ARG 308 308 308 ARG ARG A . n A 1 309 LYS 309 309 309 LYS LYS A . n A 1 310 VAL 310 310 310 VAL VAL A . n A 1 311 GLU 311 311 311 GLU GLU A . n A 1 312 ALA 312 312 312 ALA ALA A . n A 1 313 PRO 313 313 313 PRO PRO A . n A 1 314 PHE 314 314 314 PHE PHE A . n A 1 315 ILE 315 315 315 ILE ILE A . n A 1 316 PRO 316 316 316 PRO PRO A . n A 1 317 LYS 317 317 317 LYS LYS A . n A 1 318 PHE 318 318 318 PHE PHE A . n A 1 319 LYS 319 319 319 LYS LYS A . n A 1 320 GLY 320 320 320 GLY GLY A . n A 1 321 PRO 321 321 321 PRO PRO A . n A 1 322 GLY 322 322 322 GLY GLY A . n A 1 323 ASP 323 323 323 ASP ASP A . n A 1 324 THR 324 324 324 THR THR A . n A 1 325 SER 325 325 325 SER SER A . n A 1 326 ASN 326 326 326 ASN ASN A . n A 1 327 PHE 327 327 327 PHE PHE A . n A 1 328 ASP 328 328 328 ASP ASP A . n A 1 329 ASP 329 329 329 ASP ASP A . n A 1 330 TYR 330 330 330 TYR TYR A . n A 1 331 GLU 331 331 331 GLU GLU A . n A 1 332 GLU 332 332 332 GLU GLU A . n A 1 333 GLU 333 333 333 GLU GLU A . n A 1 334 GLU 334 334 334 GLU GLU A . n A 1 335 ILE 335 335 335 ILE ILE A . n A 1 336 ARG 336 336 336 ARG ARG A . n A 1 337 VAL 337 337 337 VAL VAL A . n A 1 338 SEP 338 338 338 SEP SEP A . n A 1 339 ILE 339 339 339 ILE ILE A . n A 1 340 ASN 340 340 340 ASN ASN A . n A 1 341 GLU 341 341 341 GLU GLU A . n A 1 342 LYS 342 342 342 LYS LYS A . n A 1 343 CYS 343 343 343 CYS CYS A . n A 1 344 GLY 344 344 344 GLY GLY A . n A 1 345 LYS 345 345 345 LYS LYS A . n A 1 346 GLU 346 346 346 GLU GLU A . n A 1 347 PHE 347 347 347 PHE PHE A . n A 1 348 SER 348 348 348 SER SER A . n A 1 349 GLU 349 349 349 GLU GLU A . n A 1 350 PHE 350 350 350 PHE PHE A . n B 2 1 THR 1 5 5 THR THR I . n B 2 2 THR 2 6 6 THR THR I . n B 2 3 TYR 3 7 7 TYR TYR I . n B 2 4 ALA 4 8 8 ALA ALA I . n B 2 5 ASP 5 9 9 ASP ASP I . n B 2 6 PHE 6 10 10 PHE PHE I . n B 2 7 ILE 7 11 11 ILE ILE I . n B 2 8 ALA 8 12 12 ALA ALA I . n B 2 9 SER 9 13 13 SER SER I . n B 2 10 GLY 10 14 14 GLY GLY I . n B 2 11 ARG 11 15 15 ARG ARG I . n B 2 12 THR 12 16 16 THR THR I . n B 2 13 GLY 13 17 17 GLY GLY I . n B 2 14 ARG 14 18 18 ARG ARG I . n B 2 15 ARG 15 19 19 ARG ARG I . n B 2 16 ASN 16 20 20 ASN ASN I . n B 2 17 ALA 17 21 21 ALA ALA I . n B 2 18 ILE 18 22 22 ILE ILE I . n B 2 19 HIS 19 23 23 HIS HIS I . n B 2 20 ASP 20 24 24 ASP ASP I . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 MG8 1 500 500 MG8 MG8 A . D 4 HOH 1 501 21 HOH HOH A . D 4 HOH 2 502 33 HOH HOH A . D 4 HOH 3 503 39 HOH HOH A . D 4 HOH 4 504 57 HOH HOH A . D 4 HOH 5 505 58 HOH HOH A . D 4 HOH 6 506 59 HOH HOH A . D 4 HOH 7 507 60 HOH HOH A . D 4 HOH 8 508 61 HOH HOH A . D 4 HOH 9 509 63 HOH HOH A . D 4 HOH 10 510 65 HOH HOH A . D 4 HOH 11 511 66 HOH HOH A . D 4 HOH 12 512 67 HOH HOH A . D 4 HOH 13 513 68 HOH HOH A . D 4 HOH 14 514 69 HOH HOH A . D 4 HOH 15 515 70 HOH HOH A . D 4 HOH 16 516 73 HOH HOH A . D 4 HOH 17 517 80 HOH HOH A . D 4 HOH 18 518 82 HOH HOH A . D 4 HOH 19 519 88 HOH HOH A . D 4 HOH 20 520 94 HOH HOH A . D 4 HOH 21 521 95 HOH HOH A . D 4 HOH 22 522 98 HOH HOH A . D 4 HOH 23 523 99 HOH HOH A . D 4 HOH 24 524 106 HOH HOH A . D 4 HOH 25 525 108 HOH HOH A . D 4 HOH 26 526 109 HOH HOH A . D 4 HOH 27 527 110 HOH HOH A . D 4 HOH 28 528 111 HOH HOH A . D 4 HOH 29 529 113 HOH HOH A . D 4 HOH 30 530 114 HOH HOH A . D 4 HOH 31 531 120 HOH HOH A . D 4 HOH 32 532 121 HOH HOH A . D 4 HOH 33 533 122 HOH HOH A . D 4 HOH 34 534 123 HOH HOH A . D 4 HOH 35 535 124 HOH HOH A . D 4 HOH 36 536 127 HOH HOH A . D 4 HOH 37 537 128 HOH HOH A . D 4 HOH 38 538 130 HOH HOH A . D 4 HOH 39 539 131 HOH HOH A . D 4 HOH 40 540 133 HOH HOH A . D 4 HOH 41 541 136 HOH HOH A . D 4 HOH 42 542 138 HOH HOH A . D 4 HOH 43 543 139 HOH HOH A . D 4 HOH 44 544 140 HOH HOH A . D 4 HOH 45 545 142 HOH HOH A . D 4 HOH 46 546 144 HOH HOH A . D 4 HOH 47 547 145 HOH HOH A . D 4 HOH 48 548 147 HOH HOH A . D 4 HOH 49 549 153 HOH HOH A . D 4 HOH 50 550 156 HOH HOH A . D 4 HOH 51 551 160 HOH HOH A . D 4 HOH 52 552 162 HOH HOH A . D 4 HOH 53 553 2 HOH HOH A . D 4 HOH 54 554 3 HOH HOH A . D 4 HOH 55 555 4 HOH HOH A . D 4 HOH 56 556 5 HOH HOH A . D 4 HOH 57 557 7 HOH HOH A . D 4 HOH 58 558 8 HOH HOH A . D 4 HOH 59 559 9 HOH HOH A . D 4 HOH 60 560 10 HOH HOH A . D 4 HOH 61 561 11 HOH HOH A . D 4 HOH 62 562 12 HOH HOH A . D 4 HOH 63 563 15 HOH HOH A . D 4 HOH 64 564 16 HOH HOH A . D 4 HOH 65 565 17 HOH HOH A . D 4 HOH 66 566 18 HOH HOH A . D 4 HOH 67 567 19 HOH HOH A . D 4 HOH 68 568 20 HOH HOH A . D 4 HOH 69 569 22 HOH HOH A . D 4 HOH 70 570 23 HOH HOH A . D 4 HOH 71 571 24 HOH HOH A . D 4 HOH 72 572 25 HOH HOH A . D 4 HOH 73 573 26 HOH HOH A . D 4 HOH 74 574 28 HOH HOH A . D 4 HOH 75 575 29 HOH HOH A . D 4 HOH 76 576 30 HOH HOH A . D 4 HOH 77 577 31 HOH HOH A . D 4 HOH 78 578 32 HOH HOH A . D 4 HOH 79 579 35 HOH HOH A . D 4 HOH 80 580 36 HOH HOH A . D 4 HOH 81 581 37 HOH HOH A . D 4 HOH 82 582 39 HOH HOH A . D 4 HOH 83 583 40 HOH HOH A . D 4 HOH 84 584 41 HOH HOH A . D 4 HOH 85 585 42 HOH HOH A . D 4 HOH 86 586 43 HOH HOH A . D 4 HOH 87 587 44 HOH HOH A . D 4 HOH 88 588 45 HOH HOH A . D 4 HOH 89 589 46 HOH HOH A . D 4 HOH 90 590 48 HOH HOH A . D 4 HOH 91 591 49 HOH HOH A . D 4 HOH 92 592 50 HOH HOH A . D 4 HOH 93 593 53 HOH HOH A . D 4 HOH 94 594 54 HOH HOH A . D 4 HOH 95 595 55 HOH HOH A . D 4 HOH 96 596 56 HOH HOH A . D 4 HOH 97 597 58 HOH HOH A . D 4 HOH 98 598 59 HOH HOH A . D 4 HOH 99 599 60 HOH HOH A . D 4 HOH 100 600 61 HOH HOH A . D 4 HOH 101 601 62 HOH HOH A . D 4 HOH 102 602 64 HOH HOH A . D 4 HOH 103 603 65 HOH HOH A . D 4 HOH 104 604 69 HOH HOH A . D 4 HOH 105 605 70 HOH HOH A . D 4 HOH 106 606 71 HOH HOH A . D 4 HOH 107 607 72 HOH HOH A . D 4 HOH 108 608 73 HOH HOH A . D 4 HOH 109 609 74 HOH HOH A . D 4 HOH 110 610 76 HOH HOH A . D 4 HOH 111 611 77 HOH HOH A . D 4 HOH 112 612 78 HOH HOH A . D 4 HOH 113 613 82 HOH HOH A . D 4 HOH 114 614 84 HOH HOH A . D 4 HOH 115 615 86 HOH HOH A . D 4 HOH 116 616 89 HOH HOH A . D 4 HOH 117 617 90 HOH HOH A . D 4 HOH 118 618 91 HOH HOH A . D 4 HOH 119 619 93 HOH HOH A . D 4 HOH 120 620 95 HOH HOH A . D 4 HOH 121 621 98 HOH HOH A . D 4 HOH 122 622 99 HOH HOH A . D 4 HOH 123 623 100 HOH HOH A . D 4 HOH 124 624 101 HOH HOH A . D 4 HOH 125 625 102 HOH HOH A . D 4 HOH 126 626 103 HOH HOH A . D 4 HOH 127 627 104 HOH HOH A . D 4 HOH 128 628 105 HOH HOH A . D 4 HOH 129 629 106 HOH HOH A . D 4 HOH 130 630 107 HOH HOH A . D 4 HOH 131 631 108 HOH HOH A . D 4 HOH 132 632 109 HOH HOH A . D 4 HOH 133 633 202 HOH HOH A . D 4 HOH 134 634 204 HOH HOH A . D 4 HOH 135 635 206 HOH HOH A . D 4 HOH 136 636 210 HOH HOH A . D 4 HOH 137 637 212 HOH HOH A . D 4 HOH 138 638 214 HOH HOH A . D 4 HOH 139 639 216 HOH HOH A . D 4 HOH 140 640 220 HOH HOH A . E 4 HOH 1 41 134 HOH HOH I . E 4 HOH 2 54 1 HOH HOH I . E 4 HOH 3 59 6 HOH HOH I . E 4 HOH 4 66 14 HOH HOH I . E 4 HOH 5 73 21 HOH HOH I . E 4 HOH 6 79 27 HOH HOH I . E 4 HOH 7 85 33 HOH HOH I . E 4 HOH 8 86 34 HOH HOH I . E 4 HOH 9 90 38 HOH HOH I . E 4 HOH 10 99 47 HOH HOH I . E 4 HOH 11 103 52 HOH HOH I . E 4 HOH 12 108 57 HOH HOH I . E 4 HOH 13 114 63 HOH HOH I . E 4 HOH 14 123 75 HOH HOH I . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A TPO 197 A TPO 197 ? THR PHOSPHOTHREONINE 2 A SEP 338 A SEP 338 ? SER PHOSPHOSERINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2540 ? 1 MORE 3 ? 1 'SSA (A^2)' 16290 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-09-30 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp 2 4 'Structure model' database_2 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_chem_comp.pdbx_synonyms' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.24 ? 1 SAINT 'data reduction' . ? 2 SAINT 'data scaling' . ? 3 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 125.00 120.30 4.70 0.50 N 2 1 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH2 A ARG 133 ? ? 115.70 120.30 -4.60 0.50 N 3 1 CB A ASP 241 ? ? CG A ASP 241 ? ? OD2 A ASP 241 ? ? 123.88 118.30 5.58 0.90 N 4 1 NE I ARG 15 ? ? CZ I ARG 15 ? ? NH2 I ARG 15 ? ? 115.59 120.30 -4.71 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 184 ? ? 65.32 95.24 2 1 LEU A 273 ? ? -91.46 53.27 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LYS 16 ? CE ? A LYS 16 CE 2 1 Y 0 A LYS 16 ? NZ ? A LYS 16 NZ 3 1 Y 0 A GLU 17 ? CG ? A GLU 17 CG 4 1 Y 0 A GLU 17 ? CD ? A GLU 17 CD 5 1 Y 0 A GLU 17 ? OE1 ? A GLU 17 OE1 6 1 Y 0 A GLU 17 ? OE2 ? A GLU 17 OE2 7 1 Y 0 A LYS 21 ? CD ? A LYS 21 CD 8 1 Y 0 A LYS 21 ? CE ? A LYS 21 CE 9 1 Y 0 A LYS 21 ? NZ ? A LYS 21 NZ 10 1 Y 0 A LYS 23 ? CE ? A LYS 23 CE 11 1 Y 0 A LYS 23 ? NZ ? A LYS 23 NZ 12 1 Y 0 A GLU 24 ? CG ? A GLU 24 CG 13 1 Y 0 A GLU 24 ? CD ? A GLU 24 CD 14 1 Y 0 A GLU 24 ? OE1 ? A GLU 24 OE1 15 1 Y 0 A GLU 24 ? OE2 ? A GLU 24 OE2 16 1 Y 0 A LYS 28 ? CG ? A LYS 28 CG 17 1 Y 0 A LYS 28 ? CD ? A LYS 28 CD 18 1 Y 0 A LYS 28 ? CE ? A LYS 28 CE 19 1 Y 0 A LYS 28 ? NZ ? A LYS 28 NZ 20 1 Y 0 A LYS 213 ? CD ? A LYS 213 CD 21 1 Y 0 A LYS 213 ? CE ? A LYS 213 CE 22 1 Y 0 A LYS 213 ? NZ ? A LYS 213 NZ 23 1 Y 0 A GLN 242 ? CG ? A GLN 242 CG 24 1 Y 0 A GLN 242 ? CD ? A GLN 242 CD 25 1 Y 0 A GLN 242 ? OE1 ? A GLN 242 OE1 26 1 Y 0 A GLN 242 ? NE2 ? A GLN 242 NE2 27 1 Y 0 A LYS 254 ? CD ? A LYS 254 CD 28 1 Y 0 A LYS 254 ? CE ? A LYS 254 CE 29 1 Y 0 A LYS 254 ? NZ ? A LYS 254 NZ 30 1 Y 0 A LYS 279 ? CE ? A LYS 279 CE 31 1 Y 0 A LYS 279 ? NZ ? A LYS 279 NZ 32 1 Y 0 A LYS 285 ? CG ? A LYS 285 CG 33 1 Y 0 A LYS 285 ? CD ? A LYS 285 CD 34 1 Y 0 A LYS 285 ? CE ? A LYS 285 CE 35 1 Y 0 A LYS 285 ? NZ ? A LYS 285 NZ 36 1 Y 0 A LYS 295 ? CE ? A LYS 295 CE 37 1 Y 0 A LYS 295 ? NZ ? A LYS 295 NZ 38 1 Y 0 A LYS 309 ? CE ? A LYS 309 CE 39 1 Y 0 A LYS 309 ? NZ ? A LYS 309 NZ 40 1 Y 0 A GLU 311 ? CG ? A GLU 311 CG 41 1 Y 0 A GLU 311 ? CD ? A GLU 311 CD 42 1 Y 0 A GLU 311 ? OE1 ? A GLU 311 OE1 43 1 Y 0 A GLU 311 ? OE2 ? A GLU 311 OE2 44 1 Y 0 A LYS 317 ? CG ? A LYS 317 CG 45 1 Y 0 A LYS 317 ? CD ? A LYS 317 CD 46 1 Y 0 A LYS 317 ? CE ? A LYS 317 CE 47 1 Y 0 A LYS 317 ? NZ ? A LYS 317 NZ 48 1 Y 0 A LYS 319 ? CG ? A LYS 319 CG 49 1 Y 0 A LYS 319 ? CD ? A LYS 319 CD 50 1 Y 0 A LYS 319 ? CE ? A LYS 319 CE 51 1 Y 0 A LYS 319 ? NZ ? A LYS 319 NZ 52 1 Y 0 A GLU 331 ? CG ? A GLU 331 CG 53 1 Y 0 A GLU 331 ? CD ? A GLU 331 CD 54 1 Y 0 A GLU 331 ? OE1 ? A GLU 331 OE1 55 1 Y 0 A GLU 331 ? OE2 ? A GLU 331 OE2 56 1 Y 0 A GLU 333 ? CG ? A GLU 333 CG 57 1 Y 0 A GLU 333 ? CD ? A GLU 333 CD 58 1 Y 0 A GLU 333 ? OE1 ? A GLU 333 OE1 59 1 Y 0 A GLU 333 ? OE2 ? A GLU 333 OE2 60 1 Y 0 A GLU 334 ? CG ? A GLU 334 CG 61 1 Y 0 A GLU 334 ? CD ? A GLU 334 CD 62 1 Y 0 A GLU 334 ? OE1 ? A GLU 334 OE1 63 1 Y 0 A GLU 334 ? OE2 ? A GLU 334 OE2 64 1 Y 0 A ARG 336 ? CG ? A ARG 336 CG 65 1 Y 0 A ARG 336 ? CD ? A ARG 336 CD 66 1 Y 0 A ARG 336 ? NE ? A ARG 336 NE 67 1 Y 0 A ARG 336 ? CZ ? A ARG 336 CZ 68 1 Y 0 A ARG 336 ? NH1 ? A ARG 336 NH1 69 1 Y 0 A ARG 336 ? NH2 ? A ARG 336 NH2 70 1 Y 0 A LYS 345 ? NZ ? A LYS 345 NZ 71 1 N 1 A MG8 500 ? O8 ? C MG8 1 O8 72 1 N 1 A MG8 500 ? N ? C MG8 1 N 73 1 N 1 A MG8 500 ? C9 ? C MG8 1 C9 74 1 N 1 A MG8 500 ? C10 ? C MG8 1 C10 75 1 N 1 A MG8 500 ? O10 ? C MG8 1 O10 76 1 N 1 A MG8 500 ? C11 ? C MG8 1 C11 77 1 N 1 A MG8 500 ? O11 ? C MG8 1 O11 78 1 N 1 A MG8 500 ? C12 ? C MG8 1 C12 79 1 N 1 A MG8 500 ? O12 ? C MG8 1 O12 80 1 N 1 A MG8 500 ? C13 ? C MG8 1 C13 81 1 N 1 A MG8 500 ? O13 ? C MG8 1 O13 82 1 N 1 A MG8 500 ? C14 ? C MG8 1 C14 83 1 N 1 A MG8 500 ? O14 ? C MG8 1 O14 84 1 N 1 A MG8 500 ? C15 ? C MG8 1 C15 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A ALA 4 ? A ALA 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A GLU 11 ? A GLU 11 12 1 Y 1 A GLN 12 ? A GLN 12 13 1 Y 1 A GLU 13 ? A GLU 13 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 N-OCTANOYL-N-METHYLGLUCAMINE MG8 4 water HOH #