data_1QQI # _entry.id 1QQI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1QQI pdb_00001qqi 10.2210/pdb1qqi/pdb RCSB RCSB009148 ? ? WWPDB D_1000009148 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id trt001000190.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QQI _pdbx_database_status.recvd_initial_deposition_date 1999-06-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Okamura, H.' 1 'Hanaoka, S.' 2 'Nagadoi, A.' 3 'Makino, K.' 4 'Nishimura, Y.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title ;Structural comparison of the PhoB and OmpR DNA-binding/transactivation domains and the arrangement of PhoB molecules on the phosphate box. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 295 _citation.page_first 1225 _citation.page_last 1236 _citation.year 2000 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10653699 _citation.pdbx_database_id_DOI 10.1006/jmbi.1999.3379 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Okamura, H.' 1 ? primary 'Hanaoka, S.' 2 ? primary 'Nagadoi, A.' 3 ? primary 'Makino, K.' 4 ? primary 'Nishimura, Y.' 5 ? # _cell.entry_id 1QQI _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QQI _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN PHOB' _entity.formula_weight 12173.898 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-TERMINAL DOMAIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKA LEPGGHDRMVQTVRGTGYRFSTRF ; _entity_poly.pdbx_seq_one_letter_code_can ;MAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKA LEPGGHDRMVQTVRGTGYRFSTRF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier trt001000190.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 VAL n 1 4 GLU n 1 5 GLU n 1 6 VAL n 1 7 ILE n 1 8 GLU n 1 9 MET n 1 10 GLN n 1 11 GLY n 1 12 LEU n 1 13 SER n 1 14 LEU n 1 15 ASP n 1 16 PRO n 1 17 THR n 1 18 SER n 1 19 HIS n 1 20 ARG n 1 21 VAL n 1 22 MET n 1 23 ALA n 1 24 GLY n 1 25 GLU n 1 26 GLU n 1 27 PRO n 1 28 LEU n 1 29 GLU n 1 30 MET n 1 31 GLY n 1 32 PRO n 1 33 THR n 1 34 GLU n 1 35 PHE n 1 36 LYS n 1 37 LEU n 1 38 LEU n 1 39 HIS n 1 40 PHE n 1 41 PHE n 1 42 MET n 1 43 THR n 1 44 HIS n 1 45 PRO n 1 46 GLU n 1 47 ARG n 1 48 VAL n 1 49 TYR n 1 50 SER n 1 51 ARG n 1 52 GLU n 1 53 GLN n 1 54 LEU n 1 55 LEU n 1 56 ASN n 1 57 HIS n 1 58 VAL n 1 59 TRP n 1 60 GLY n 1 61 THR n 1 62 ASN n 1 63 VAL n 1 64 TYR n 1 65 VAL n 1 66 GLU n 1 67 ASP n 1 68 ARG n 1 69 THR n 1 70 VAL n 1 71 ASP n 1 72 VAL n 1 73 HIS n 1 74 ILE n 1 75 ARG n 1 76 ARG n 1 77 LEU n 1 78 ARG n 1 79 LYS n 1 80 ALA n 1 81 LEU n 1 82 GLU n 1 83 PRO n 1 84 GLY n 1 85 GLY n 1 86 HIS n 1 87 ASP n 1 88 ARG n 1 89 MET n 1 90 VAL n 1 91 GLN n 1 92 THR n 1 93 VAL n 1 94 ARG n 1 95 GLY n 1 96 THR n 1 97 GLY n 1 98 TYR n 1 99 ARG n 1 100 PHE n 1 101 SER n 1 102 THR n 1 103 ARG n 1 104 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PT7-7-CB _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PHOB_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P08402 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QQI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08402 _struct_ref_seq.db_align_beg 126 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 229 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 104 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 3 2 1 3D_13C-SEPARATED_NOESY 1 3 1 3D_15N-SEPARATED_NOESY 2 4 1 4D_13C-SEPARATED_NOESY 1 5 1 HNHA 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'NACL 500mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1-2MM PROTEIN U-15N,13C; 50MM PHOSPHATE BUFFER, 500MM NACL' ? 2 '1-2MM PROTEIN U-15N; 50MM PHOSPHATE BUFFER, 500MM NACL' ? 3 '1-2MM PROTEIN ; 50MM PHOSPHATE BUFFER, 500MM NACL' ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX Bruker 600 ? 2 AMX Bruker 500 ? # _pdbx_nmr_refine.entry_id 1QQI _pdbx_nmr_refine.method '4D SIMULATED ANNEALING' _pdbx_nmr_refine.details ;THE STRUCTURES ARE BASED ON A TOTAL OF 1758 RESTRAINTS, 1719 ARE NOE-DERIVED DISTANCE RESTRAINTS AND 39 DIHEDRAL ANGLE RESTRAINTS. STRUCTURE CALCULATIONS WERE PERFORMED WITH EMBOSS BY USING A 4D SIMULATED ANNEALING PROTOCOL STARTING FROM A RANDOM COIL CONFORMATION. THE GENERATED STRUCTURES WERE FURTHER REFINED BY ENERGY MINIMIZATION USING THE AMBER FORCE FIELD. THE FINAL STRUCTURES WERE SELECTED BY HAVING NO DISTANCE VIOLATIONS GREATER THAN 0.3 ANGSTROMS AND NO DIHEDRAL ANGLE VIOLATIONS GREATER THAN 5 DEGREES, AND A LOW TARGET ENERGY. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1QQI _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY.' # _pdbx_nmr_ensemble.entry_id 1QQI _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' NMRPipe 1.6 'DELAGLIO, F.' 1 'structure solution' PIPP 3.9 'GARRETT, D.S.' 2 refinement EMBOSS 5 'NAKAI,T., KIDERA, A. AND NAKAMURA, H.' 3 # _exptl.entry_id 1QQI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1QQI _struct.title 'SOLUTION STRUCTURE OF THE DNA-BINDING AND TRANSACTIVATION DOMAIN OF PHOB FROM ESCHERICHIA COLI' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QQI _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'WINGED HELIX-TURN-HELIX, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSCRIPTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 31 ? HIS A 44 ? GLY A 31 HIS A 44 1 ? 14 HELX_P HELX_P2 2 ARG A 51 ? VAL A 58 ? ARG A 51 VAL A 58 1 ? 8 HELX_P HELX_P3 3 GLU A 66 ? GLU A 82 ? GLU A 66 GLU A 82 1 ? 17 HELX_P HELX_P4 4 GLY A 85 ? ARG A 88 ? GLY A 85 ARG A 88 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 7 ? MET A 9 ? ILE A 7 MET A 9 A 2 LEU A 12 ? ASP A 15 ? LEU A 12 ASP A 15 A 3 ARG A 20 ? ALA A 23 ? ARG A 20 ALA A 23 A 4 GLU A 26 ? LEU A 28 ? GLU A 26 LEU A 28 B 1 TYR A 49 ? SER A 50 ? TYR A 49 SER A 50 B 2 GLY A 97 ? PHE A 100 ? GLY A 97 PHE A 100 B 3 VAL A 90 ? VAL A 93 ? VAL A 90 VAL A 93 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O MET A 9 ? O MET A 9 N LEU A 12 ? N LEU A 12 A 2 3 N ASP A 15 ? N ASP A 15 O ARG A 20 ? O ARG A 20 A 3 4 N ALA A 23 ? N ALA A 23 O GLU A 26 ? O GLU A 26 B 1 2 N TYR A 49 ? N TYR A 49 O TYR A 98 ? O TYR A 98 B 2 3 O ARG A 99 ? O ARG A 99 N GLN A 91 ? N GLN A 91 # _database_PDB_matrix.entry_id 1QQI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QQI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 PHE 104 104 104 PHE PHE A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-06-07 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -167.68 118.30 2 1 VAL A 3 ? ? -160.12 107.79 3 1 GLU A 4 ? ? 50.18 -119.16 4 1 GLU A 25 ? ? -155.84 -40.14 5 1 HIS A 57 ? ? -117.73 -70.21 6 1 ARG A 94 ? ? 50.54 -137.40 7 1 ARG A 103 ? ? -169.80 -53.39 #